Homologs in group_2138

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15815 FBDBKF_15815 97.9 Morganella morganii S1 araJ putative arabinose efflux permease AraJ, MFS family
EHELCC_19635 EHELCC_19635 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_19640 NLDBIP_19640 100.0 Morganella morganii S4 - hypothetical protein
LHKJJB_19580 LHKJJB_19580 100.0 Morganella morganii S3 - hypothetical protein
F4V73_RS16495 F4V73_RS16495 70.8 Morganella psychrotolerans - MFS transporter
PMI_RS00495 PMI_RS00495 35.4 Proteus mirabilis HI4320 - MFS transporter

Distribution of the homologs in the orthogroup group_2138

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2138

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S5
Locus tag HKOGLL_19520
Feature type CDS
Gene -
Product hypothetical protein
Location 4531 - 4677 (strand: -1)
Length 147 (nucleotides) / 48 (amino acids)
In genomic island -

Contig

Accession ZDB_717
Length 4691 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2138
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF21987 YajR YAM domain

Protein Sequence

MNNPDIAVKLRGQPGVRDVVIIAQERAVYVKTDTRLSNRKQLEAVLQS

Flanking regions ( +/- flanking 50bp)

ACCGGAAAATGACGTGAATAATCCGGATATTGCCGTGAAATTACGCGGACAGCCGGGTGTGCGTGATGTGGTGATTATTGCGCAGGAACGGGCGGTGTATGTGAAAACGGATACCAGACTGTCAAACCGCAAACAACTCGAAGCCGTTTTACAGAGCTGACAGGAACCGGCAACCATGCTGATGCAGGTTGCCGGATAACACTCAGTCGC