Homologs in group_2129

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15705 FBDBKF_15705 85.0 Morganella morganii S1 merD mercury resistance co-regulator MerD
FBDBKF_20220 FBDBKF_20220 100.0 Morganella morganii S1 merD mercury resistance co-regulator MerD
EHELCC_16060 EHELCC_16060 85.0 Morganella morganii S2 merD mercury resistance co-regulator MerD
NLDBIP_16305 NLDBIP_16305 85.0 Morganella morganii S4 merD mercury resistance co-regulator MerD
LHKJJB_16495 LHKJJB_16495 85.0 Morganella morganii S3 merD mercury resistance co-regulator MerD
HKOGLL_16265 HKOGLL_16265 85.0 Morganella morganii S5 merD mercury resistance co-regulator MerD

Distribution of the homologs in the orthogroup group_2129

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2129

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P20102 1.25e-79 232 99 0 120 4 merD HTH-type transcriptional regulator MerD Shigella flexneri
Q52110 7.86e-63 190 83 1 121 4 merD HTH-type transcriptional regulator MerD Acinetobacter calcoaceticus
P0A2Q6 1.71e-61 186 82 1 121 4 merD HTH-type transcriptional regulator MerD Salmonella typhi
P0A2Q7 1.71e-61 186 82 1 121 4 merD HTH-type transcriptional regulator MerD Enterobacter agglomerans
P08654 8.78e-61 185 80 1 121 4 merD HTH-type transcriptional regulator MerD Serratia marcescens
P06689 1.6e-54 169 80 1 121 4 merD HTH-type transcriptional regulator MerD Pseudomonas aeruginosa
Q51773 9.81e-29 102 89 0 55 4 merD HTH-type transcriptional regulator MerD (Fragment) Pseudomonas fluorescens
P44617 4.77e-06 45 28 2 100 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P71039 1.05e-05 46 28 0 107 1 mta HTH-type transcriptional activator mta Bacillus subtilis (strain 168)
P0A2Q9 2.59e-05 44 30 2 110 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 2.59e-05 44 30 2 110 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
P22896 2.7e-05 43 30 0 68 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P13111 0.000113 42 30 2 110 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
B8H172 0.000117 43 43 1 58 3 skgA HTH-type transcriptional regulator SkgA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAV4 0.000117 43 43 1 58 1 skgA HTH-type transcriptional regulator SkgA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P69413 0.000166 42 29 0 105 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 0.000166 42 29 0 105 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 0.000166 42 29 0 105 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
P0ACS5 0.000267 41 30 0 66 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 0.000267 41 30 0 66 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_19585
Feature type CDS
Gene merD
Product mercury resistance co-regulator MerD
Location 2390 - 2752 (strand: -1)
Length 363 (nucleotides) / 120 (amino acids)
In genomic island -

Contig

Accession ZDB_248
Length 10748 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2129
Orthogroup size 7
N. genomes 5

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19057 MerR family transcriptional regulator, mercuric resistance operon regulatory protein - -

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
merD mercury resistance co-regulator MerD plus STRESS MERCURY MERCURY NF033783 

Protein Sequence

MSAYTVSQLAHNAGVSVHIVRDYLVRGLLRPVACTTGGYGVFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGAQAAAQLAVLRQLVERRRAALAHLDAQLASMPAERAHEEALP

Flanking regions ( +/- flanking 50bp)

GATGTGAAGCAGCTTTCCTGCTGCGCCGGGTGAGGACAAGGAGGTGTGCGATGAGCGCCTACACGGTATCGCAACTGGCCCATAACGCTGGGGTGAGCGTACATATCGTGCGCGACTACCTGGTGCGCGGCTTGTTACGGCCGGTGGCCTGCACCACGGGCGGCTACGGCGTGTTCGACGATGCGGCCTTGCAACGGCTGTGCTTCGTGCGCGCGGCCTTCGAGGCGGGTATCGGCCTGGATGCCCTGGCGCGGCTGTGCCGTGCGCTCGACGCAGCGGACGGCGCACAAGCCGCAGCGCAGCTTGCCGTGCTGCGCCAGTTGGTCGAGCGGCGGCGCGCGGCGTTGGCCCATCTGGACGCGCAACTGGCCTCCATGCCAGCCGAGCGGGCGCACGAGGAGGCATTGCCGTGAACGCCCCTGACAAACTGCCGCCCGAGACGCGCCAACCCGTTTCCGGCTAC