Homologs in group_2090

Help

6 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15705 FBDBKF_15705 100.0 Morganella morganii S1 merD mercury resistance co-regulator MerD
FBDBKF_20220 FBDBKF_20220 85.0 Morganella morganii S1 merD mercury resistance co-regulator MerD
EHELCC_19585 EHELCC_19585 85.0 Morganella morganii S2 merD mercury resistance co-regulator MerD
NLDBIP_16305 NLDBIP_16305 100.0 Morganella morganii S4 merD mercury resistance co-regulator MerD
LHKJJB_16495 LHKJJB_16495 100.0 Morganella morganii S3 merD mercury resistance co-regulator MerD
HKOGLL_16265 HKOGLL_16265 100.0 Morganella morganii S5 merD mercury resistance co-regulator MerD

Distribution of the homologs in the orthogroup group_2090

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2090

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P06689 2.07e-78 229 96 0 121 4 merD HTH-type transcriptional regulator MerD Pseudomonas aeruginosa
P08654 3e-74 219 92 0 121 4 merD HTH-type transcriptional regulator MerD Serratia marcescens
Q52110 2.5e-73 216 92 0 121 4 merD HTH-type transcriptional regulator MerD Acinetobacter calcoaceticus
P0A2Q6 4.72e-72 213 91 0 121 4 merD HTH-type transcriptional regulator MerD Salmonella typhi
P0A2Q7 4.72e-72 213 91 0 121 4 merD HTH-type transcriptional regulator MerD Enterobacter agglomerans
P20102 9.66e-54 167 83 1 121 4 merD HTH-type transcriptional regulator MerD Shigella flexneri
Q51773 6.5e-33 112 100 0 55 4 merD HTH-type transcriptional regulator MerD (Fragment) Pseudomonas fluorescens
P22896 5.12e-06 45 32 0 68 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P44617 5.15e-06 45 26 2 109 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A2Q9 4.06e-05 43 32 1 98 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 4.06e-05 43 32 1 98 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
P71039 9.57e-05 43 30 2 100 1 mta HTH-type transcriptional activator mta Bacillus subtilis (strain 168)
P13111 0.000208 41 29 0 109 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
P69413 0.000422 40 31 1 98 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 0.000422 40 31 1 98 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 0.000422 40 31 1 98 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
P0ACS5 0.000633 40 31 0 66 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 0.000633 40 31 0 66 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
P50330 0.000828 40 30 3 104 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_16060
Feature type CDS
Gene merD
Product mercury resistance co-regulator MerD
Location 74691 - 75056 (strand: -1)
Length 366 (nucleotides) / 121 (amino acids)

Contig

Accession ZDB_227
Length 79950 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2090
Orthogroup size 7
N. genomes 5

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K19057 MerR family transcriptional regulator, mercuric resistance operon regulatory protein - -

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
merD mercury resistance co-regulator MerD plus STRESS MERCURY MERCURY NF033783 

Protein Sequence

MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTPGGYGLFDDAALQRLCFVRAAFEAGIGLDALARLCRALDAADGDEAAAQLAVLRQFVERRREALADLEVQLATMPTEPAQHAESLP

Flanking regions ( +/- flanking 50bp)

GGACGTGAAGCAGCTTTCCTGCTGCGCTGGATAAAAAAAGGAGGTTTTCAATGAGCGCCTACACCGTGTCCCGGCTGGCCCTTGATGCCGGGGTGAGCGTGCATATCGTGCGCGACTACCTGCTGCGCGGATTGCTGCGTCCGGTGGCGTGCACCCCGGGCGGCTATGGCCTGTTCGATGATGCCGCCTTGCAACGGCTGTGCTTCGTGCGGGCGGCCTTCGAGGCGGGCATCGGCCTGGACGCGCTGGCGCGGCTGTGCCGGGCGCTGGATGCTGCGGACGGCGATGAAGCGGCCGCGCAGCTTGCCGTTCTGCGCCAGTTCGTCGAGCGTCGGCGCGAAGCGTTGGCCGATCTGGAGGTGCAGTTGGCCACCATGCCGACCGAGCCGGCACAGCACGCGGAGAGTCTGCCATGAACAGCCCCGAGCGCTTGCCGTCCGAGACGCACAAACCGATCACCGGCTAC