Homologs in group_2390

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19015 FBDBKF_19015 100.0 Morganella morganii S1 queD 6-carboxytetrahydropterin synthase QueD
NLDBIP_18545 NLDBIP_18545 100.0 Morganella morganii S4 queD 6-carboxytetrahydropterin synthase QueD
LHKJJB_18630 LHKJJB_18630 100.0 Morganella morganii S3 queD 6-carboxytetrahydropterin synthase QueD
HKOGLL_18365 HKOGLL_18365 100.0 Morganella morganii S5 queD 6-carboxytetrahydropterin synthase QueD
F4V73_RS13920 F4V73_RS13920 94.2 Morganella psychrotolerans queD 6-carboxytetrahydropterin synthase QueD
PMI_RS11090 PMI_RS11090 83.3 Proteus mirabilis HI4320 queD 6-carboxytetrahydropterin synthase QueD

Distribution of the homologs in the orthogroup group_2390

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2390

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P65872 1.87e-76 224 83 0 120 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Shigella flexneri
P65870 1.87e-76 224 83 0 120 1 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Escherichia coli (strain K12)
P65871 1.87e-76 224 83 0 120 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Escherichia coli O157:H7
Q8K9D8 2.38e-61 186 66 0 119 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q55798 5.91e-25 94 46 5 119 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O31676 1.91e-13 65 30 3 121 1 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Bacillus subtilis (strain 168)
O29809 7.36e-12 60 39 4 86 3 queD Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q1ZXI0 6.83e-11 58 34 4 101 3 ptsA 6-pyruvoyl tetrahydrobiopterin synthase Dictyostelium discoideum
E7FHF1 6.85e-10 55 33 4 100 1 PF1278 Dihydroneopterin monophosphate aldolase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q03393 1.05e-08 53 29 6 132 1 PTS 6-pyruvoyl tetrahydrobiopterin synthase Homo sapiens
P27213 1.47e-08 52 32 7 128 1 Pts 6-pyruvoyl tetrahydrobiopterin synthase Rattus norvegicus
O27296 2.7e-08 52 37 3 78 3 queD Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q9R1Z7 3.14e-08 52 32 7 128 1 Pts 6-pyruvoyl tetrahydrobiopterin synthase Mus musculus
Q5REZ5 4.02e-08 51 28 6 132 2 PTS 6-pyruvoyl tetrahydrobiopterin synthase Pongo abelii
P48611 7.15e-08 51 31 7 126 1 pr 6-pyruvoyl tetrahydrobiopterin synthase Drosophila melanogaster
O02058 1.35e-07 50 28 4 126 1 ptps-1 Putative 6-pyruvoyl tetrahydrobiopterin synthase Caenorhabditis elegans
P44123 3.23e-07 49 29 7 141 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O66626 2.45e-06 47 24 5 162 3 queD 6-carboxy-5,6,7,8-tetrahydropterin synthase Aquifex aeolicus (strain VF5)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18760
Feature type CDS
Gene queD
Product 6-carboxytetrahydropterin synthase QueD
Location 20106 - 20468 (strand: 1)
Length 363 (nucleotides) / 120 (amino acids)
In genomic island -

Contig

Accession ZDB_239
Length 25512 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2390
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01242 6-pyruvoyl tetrahydropterin synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0720 Coenzyme transport and metabolism (H) H 6-pyruvoyl-tetrahydropterin synthase

Kegg Ortholog Annotation(s)

Protein Sequence

MSTTIFKEFQFEAAHRLPHVPEGHKCGRLHGHSFLVRLELSGEVDAHTGWLIDFAEVKQAFKPIYDRLDHHYLNEIPGLENPTSEVLAEWIWQQTKPLLPMLSAVLVKETCTAGCIYRGE

Flanking regions ( +/- flanking 50bp)

CGTAAAATGACGCTTTTATTACGCCAGACCGTCATTATCCGGAGAGAGTTATGAGCACCACGATTTTTAAAGAGTTCCAGTTCGAAGCCGCCCACCGCCTGCCGCATGTCCCGGAAGGCCATAAATGCGGGCGTCTGCACGGGCATTCCTTTCTTGTCCGTCTGGAGCTGAGTGGTGAAGTGGATGCACATACCGGCTGGCTGATCGACTTTGCTGAGGTCAAACAGGCATTTAAACCAATTTATGACCGTCTGGATCATCACTATCTCAATGAGATCCCGGGGCTGGAAAACCCGACCAGTGAAGTACTGGCAGAGTGGATCTGGCAGCAGACCAAACCGCTGCTGCCGATGCTGAGTGCCGTGCTGGTCAAAGAGACCTGTACCGCAGGCTGTATTTACCGCGGTGAATAATCAGGCAATATTAAGATATTTATGAGTCTGCATCGAGAAACGCCAGTTAC