Homologs in group_486

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17695 FBDBKF_17695 100.0 Morganella morganii S1 hupA nucleoid-associated protein HU-alpha
NLDBIP_17970 NLDBIP_17970 100.0 Morganella morganii S4 hupA nucleoid-associated protein HU-alpha
LHKJJB_18165 LHKJJB_18165 100.0 Morganella morganii S3 hupA nucleoid-associated protein HU-alpha
HKOGLL_18035 HKOGLL_18035 100.0 Morganella morganii S5 hupA nucleoid-associated protein HU-alpha
F4V73_RS15075 F4V73_RS15075 94.4 Morganella psychrotolerans hupA nucleoid-associated protein HU-alpha
PMI_RS13685 PMI_RS13685 77.8 Proteus mirabilis HI4320 - HU family DNA-binding protein

Distribution of the homologs in the orthogroup group_486

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_486

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACF3 1.68e-55 169 93 0 90 3 hupA DNA-binding protein HU-alpha Shigella flexneri
E0J6W8 1.68e-55 169 93 0 90 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
P0ACF0 1.68e-55 169 93 0 90 1 hupA DNA-binding protein HU-alpha Escherichia coli (strain K12)
P0ACF1 1.68e-55 169 93 0 90 3 hupA DNA-binding protein HU-alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF2 1.68e-55 169 93 0 90 3 hupA DNA-binding protein HU-alpha Escherichia coli O157:H7
P0A1R6 6.15e-55 167 92 0 90 3 hupA DNA-binding protein HU-alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R7 6.15e-55 167 92 0 90 3 hupA DNA-binding protein HU-alpha Salmonella typhi
P52680 7.94e-54 165 90 0 90 3 hupA DNA-binding protein HU-alpha Serratia marcescens
P28080 4.35e-49 153 83 0 90 3 hupA DNA-binding protein HU-alpha Vibrio proteolyticus
Q9LA96 5.62e-48 150 82 0 90 3 hupA DNA-binding protein HU-alpha Aeromonas hydrophila
Q9KV83 1.88e-46 146 77 0 90 3 hupA DNA-binding protein HU-alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P43722 4e-43 138 76 0 90 3 hup DNA-binding protein HU Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CK94 2.47e-42 135 76 0 90 3 hup DNA-binding protein HU Pasteurella multocida (strain Pm70)
P57144 2.93e-41 133 66 0 90 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA69 1.02e-37 124 63 0 90 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P0ACF7 2.51e-37 123 69 0 89 3 hupB DNA-binding protein HU-beta Shigella flexneri
P0ACF4 2.51e-37 123 69 0 89 1 hupB DNA-binding protein HU-beta Escherichia coli (strain K12)
P0ACF5 2.51e-37 123 69 0 89 3 hupB DNA-binding protein HU-beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACF6 2.51e-37 123 69 0 89 3 hupB DNA-binding protein HU-beta Escherichia coli O157:H7
P52681 5.97e-37 122 68 0 89 3 hupB DNA-binding protein HU-beta Serratia marcescens
P0A1R8 1.64e-36 121 68 0 89 3 hupB DNA-binding protein HU-beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1R9 1.64e-36 121 68 0 89 3 hupB DNA-binding protein HU-beta Salmonella typhi
P05384 2.9e-34 115 64 0 89 1 hupB DNA-binding protein HU-beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q89B22 8.9e-34 114 58 0 90 3 hup DNA-binding protein HU Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q87E48 9.33e-34 114 61 0 90 3 hup DNA-binding protein HU Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q7A0U9 3.69e-33 112 60 0 90 3 hup DNA-binding protein HU Staphylococcus aureus (strain MW2)
Q6G990 3.69e-33 112 60 0 90 3 hup DNA-binding protein HU Staphylococcus aureus (strain MSSA476)
Q6GGT8 3.69e-33 112 60 0 90 3 hup DNA-binding protein HU Staphylococcus aureus (strain MRSA252)
Q7A5J1 3.69e-33 112 60 0 90 1 hup DNA-binding protein HU Staphylococcus aureus (strain N315)
Q99U17 3.69e-33 112 60 0 90 1 hup DNA-binding protein HU Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFV0 3.69e-33 112 60 0 90 3 hup DNA-binding protein HU Staphylococcus aureus (strain COL)
P08821 5.93e-33 112 59 0 89 1 hbs DNA-binding protein HU 1 Bacillus subtilis (strain 168)
P64389 1.78e-32 111 60 0 89 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P64388 1.78e-32 111 60 0 89 3 hupB DNA-binding protein HU-beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A3H0 2.96e-32 110 57 0 90 1 hup DNA-binding protein HU Geobacillus stearothermophilus
P0A3H1 2.96e-32 110 57 0 90 1 hup DNA-binding protein HU Bacillus caldolyticus
P0A3H2 2.96e-32 110 57 0 90 3 hup DNA-binding protein HU Bacillus caldotenax
Q9KQS9 5.12e-32 110 60 0 89 3 hupB DNA-binding protein HU-beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9PE38 7.56e-32 109 58 0 90 3 hup DNA-binding protein HU Xylella fastidiosa (strain 9a5c)
Q9KDA5 3.02e-31 108 59 0 89 3 hup1 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9KHS6 1.84e-30 105 59 0 89 3 hupB DNA-binding protein HU-beta Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9K7K5 2.22e-30 105 55 0 90 3 hup2 DNA-binding protein HU-1 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9XB21 2.75e-29 103 56 0 89 1 hup DNA-binding protein HU Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9XB22 6.75e-29 102 57 0 89 3 hup DNA-binding protein HU Streptococcus downei
P0C0H2 2.25e-28 100 57 0 89 3 hup DNA-binding protein HU Streptococcus pyogenes
P0DB65 2.25e-28 100 57 0 89 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain SSI-1)
P0C097 2.25e-28 100 57 0 89 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB35 2.25e-28 100 57 0 89 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DB64 2.25e-28 100 57 0 89 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0H3 2.25e-28 100 57 0 89 3 hup DNA-binding protein HU Streptococcus pyogenes serotype M1
P96045 8.39e-28 99 56 0 89 3 hup DNA-binding protein HU Streptococcus thermophilus
P02344 1.33e-26 96 52 0 89 1 hupB DNA-binding protein HRm Rhizobium meliloti (strain 1021)
P68574 1.66e-26 96 52 0 90 3 hup2 DNA-binding protein HU 2 Bacillus phage SPbeta
P68573 1.66e-26 96 52 0 90 3 hup2 SPbeta prophage-derived DNA-binding protein HU 2 Bacillus subtilis (strain 168)
P0DMK4 3.57e-26 95 53 0 89 3 hupA DNA-binding protein HU-alpha Burkholderia pseudomallei (strain K96243)
I1WEI8 3.57e-26 95 53 0 89 3 hupA DNA-binding protein HU-alpha Burkholderia pseudomallei (strain 1026b)
Q9HTL0 4.07e-26 95 55 0 89 3 hupA DNA-binding protein HU-alpha Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9XB20 1.24e-25 94 58 0 89 3 hup DNA-binding protein HU Streptococcus gordonii
Q9JR30 1.72e-25 93 52 0 89 3 hupB2 DNA-binding protein HU-beta 2 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P02348 3.58e-25 92 49 0 89 1 None DNA-binding protein HRL53 Rhizobium leguminosarum
P05385 3.78e-25 92 49 0 89 1 hup DNA-binding protein HU Clostridium pasteurianum
P05514 8.74e-25 91 48 0 89 1 hup DNA-binding protein HU Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9CI64 1.1e-24 91 53 0 89 1 hup DNA-binding protein HU Lactococcus lactis subsp. lactis (strain IL1403)
P0A3H4 1.17e-22 86 49 0 89 1 None DNA-binding protein HRL18 Rhizobium radiobacter
P0A3H3 1.17e-22 86 49 0 89 1 None DNA-binding protein HRL18 Rhizobium leguminosarum
B8GX11 1.05e-21 84 51 0 87 3 hup DNA-binding protein HU Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAV2 1.05e-21 84 51 0 87 3 hup DNA-binding protein HU Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P73418 1.05e-20 81 42 1 95 3 hup DNA-binding protein HU Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P19436 2.22e-20 80 46 0 90 1 TTHA1349 DNA-binding protein HU Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q44654 2.37e-20 80 42 1 88 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q5QZ46 2.95e-20 80 39 0 89 3 ihfB Integration host factor subunit beta Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A8H4A7 3.29e-20 80 38 1 90 3 ihfB Integration host factor subunit beta Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TT46 4.13e-20 80 38 1 90 3 ihfB Integration host factor subunit beta Shewanella halifaxensis (strain HAW-EB4)
Q9ZDZ2 1.34e-19 79 39 1 98 3 hup DNA-binding protein HU Rickettsia prowazekii (strain Madrid E)
Q2SCF7 1.73e-19 78 37 1 90 3 ihfB Integration host factor subunit beta Hahella chejuensis (strain KCTC 2396)
P29214 2.74e-19 77 39 0 89 3 hup DNA-binding protein HU homolog Guillardia theta
P36206 2.85e-19 77 48 0 90 1 hup DNA-binding protein HU Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A1TZF1 3.34e-19 77 40 1 90 3 ihfB Integration host factor subunit beta Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C5BSK5 4.29e-19 77 38 1 90 3 ihfB Integration host factor subunit beta Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q608S8 4.47e-19 77 35 1 90 3 ihfB Integration host factor subunit beta Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1RJG1 5.21e-19 77 36 1 90 3 ihfB Integration host factor subunit beta Shewanella sp. (strain W3-18-1)
A4Y729 5.21e-19 77 36 1 90 3 ihfB Integration host factor subunit beta Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q5HUP6 6.02e-19 77 42 0 89 3 hup DNA-binding protein HU Campylobacter jejuni (strain RM1221)
Q46121 6.02e-19 77 42 0 89 1 hup DNA-binding protein HU Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q0ATJ4 7.59e-19 77 41 1 90 3 ihfB Integration host factor subunit beta Maricaulis maris (strain MCS10)
Q0HV14 7.89e-19 76 36 1 90 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-7)
Q0HIW8 7.89e-19 76 36 1 90 3 ihfB Integration host factor subunit beta Shewanella sp. (strain MR-4)
A0KWP0 7.89e-19 76 36 1 90 3 ihfB Integration host factor subunit beta Shewanella sp. (strain ANA-3)
Q8EEI1 7.89e-19 76 36 1 90 3 ihfB Integration host factor subunit beta Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q6LPE4 8.84e-19 76 37 1 90 3 ihfB Integration host factor subunit beta Photobacterium profundum (strain SS9)
Q1QVK5 1.44e-18 76 42 1 90 3 ihfB Integration host factor subunit beta Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1ID97 1.46e-18 76 37 1 90 3 ihfB Integration host factor subunit beta Pseudomonas entomophila (strain L48)
A3QEC3 1.57e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q482G2 1.57e-18 75 35 1 90 3 ihfB Integration host factor subunit beta Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A9L2X4 1.85e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS195)
A6WNM7 1.85e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS185)
A3D4A9 1.85e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EA98 1.85e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Shewanella baltica (strain OS223)
Q081U7 1.89e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Shewanella frigidimarina (strain NCIMB 400)
A4XTF3 1.93e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas mendocina (strain ymp)
Q47GJ8 2.05e-18 75 38 1 90 3 ihfB Integration host factor subunit beta Dechloromonas aromatica (strain RCB)
B4ET28 2.08e-18 75 37 1 90 3 ihfB Integration host factor subunit beta Proteus mirabilis (strain HI4320)
Q12ND8 2.65e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
C1DRR5 2.67e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q0AA51 2.96e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A6W0A0 3.83e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Marinomonas sp. (strain MWYL1)
A5UBN4 3.87e-18 75 40 1 90 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittEE)
Q4QJU8 3.87e-18 75 40 1 90 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain 86-028NP)
Q51473 3.91e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PW7 3.91e-18 75 36 1 90 1 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VAL8 3.91e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain LESB58)
A6V2R4 3.91e-18 75 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas aeruginosa (strain PA7)
A1WUI6 4.23e-18 75 37 1 90 3 ihfB Integration host factor subunit beta Halorhodospira halophila (strain DSM 244 / SL1)
B8F475 4.29e-18 74 38 1 90 3 ihfB Integration host factor subunit beta Glaesserella parasuis serovar 5 (strain SH0165)
A1S6D6 4.83e-18 74 35 1 90 3 ihfB Integration host factor subunit beta Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q65SH8 6.39e-18 74 37 1 90 3 ihfB Integration host factor subunit beta Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q21IT4 6.43e-18 74 37 1 90 3 ihfB Integration host factor subunit beta Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q68XJ6 6.89e-18 74 37 1 98 3 hup DNA-binding protein HU Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92J57 7.44e-18 74 35 1 98 3 hup DNA-binding protein HU Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B1KF50 7.64e-18 74 36 1 90 3 ihfB Integration host factor subunit beta Shewanella woodyi (strain ATCC 51908 / MS32)
A1K4D5 8.3e-18 74 37 1 90 3 ihfB Integration host factor subunit beta Azoarcus sp. (strain BH72)
A5EWQ2 9.54e-18 73 35 1 90 3 ihfB Integration host factor subunit beta Dichelobacter nodosus (strain VCS1703A)
B1J5H2 1.04e-17 73 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain W619)
Q87N46 1.07e-17 73 35 1 90 3 ihfB Integration host factor subunit beta Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MUP0 1.26e-17 73 35 1 90 3 ihfB Integration host factor subunit beta Vibrio campbellii (strain ATCC BAA-1116)
P95519 1.29e-17 73 37 1 90 3 ihfB Integration host factor subunit beta Mannheimia haemolytica
Q47CN0 1.35e-17 73 41 0 90 3 ihfA2 Integration host factor subunit alpha 2 Dechloromonas aromatica (strain RCB)
Q4UKH2 1.56e-17 73 35 1 98 3 hup DNA-binding protein HU Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q7MLX5 1.57e-17 73 35 1 90 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain YJ016)
A1SYZ9 1.62e-17 73 36 1 90 3 ihfB Integration host factor subunit beta Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A8IN83 1.69e-17 73 38 1 90 3 ihfB Integration host factor subunit beta Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q8D8J3 1.7e-17 73 35 1 90 3 ihfB Integration host factor subunit beta Vibrio vulnificus (strain CMCP6)
B7VH32 1.8e-17 73 35 1 90 3 ihfB Integration host factor subunit beta Vibrio atlanticus (strain LGP32)
A5UF83 1.86e-17 73 38 1 90 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain PittGG)
Q48FN3 1.87e-17 73 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q3IL99 1.91e-17 73 36 1 90 3 ihfB Integration host factor subunit beta Pseudoalteromonas translucida (strain TAC 125)
P43724 1.94e-17 73 38 1 90 3 ihfB Integration host factor subunit beta Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A129 2.25e-17 73 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida
P0A128 2.25e-17 73 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KTY3 2.65e-17 73 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain GB-1)
A5W7F5 2.65e-17 73 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q15T07 2.66e-17 72 34 1 90 3 ihfB Integration host factor subunit beta Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3K8V7 2.83e-17 72 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas fluorescens (strain Pf0-1)
C3K6K2 2.93e-17 72 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas fluorescens (strain SBW25)
Q4ZQ99 2.99e-17 72 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas syringae pv. syringae (strain B728a)
Q885T0 2.99e-17 72 36 1 90 3 ihfB Integration host factor subunit beta Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A8FVN3 3.44e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Shewanella sediminis (strain HAW-EB3)
A8LSF5 3.56e-17 72 37 1 90 3 ihfB Integration host factor subunit beta Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B2SLH4 3.67e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P3S1 3.67e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8P8P6 3.75e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RSA5 3.75e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain B100)
Q4UVD5 3.75e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Xanthomonas campestris pv. campestris (strain 8004)
Q1GZS3 3.83e-17 72 41 0 90 3 ihfA Integration host factor subunit alpha Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A7HBJ3 4.3e-17 72 37 0 89 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain Fw109-5)
Q8PK78 4.42e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Xanthomonas axonopodis pv. citri (strain 306)
A6VPK8 4.55e-17 72 37 1 90 3 ihfB Integration host factor subunit beta Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A1K4E7 5.68e-17 72 40 0 90 3 ihfA Integration host factor subunit alpha Azoarcus sp. (strain BH72)
A4SLS6 7.28e-17 71 34 1 90 3 ihfB Integration host factor subunit beta Aeromonas salmonicida (strain A449)
A0KJ94 7.6e-17 71 34 1 90 3 ihfB Integration host factor subunit beta Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B2FNP6 8.16e-17 72 36 1 90 3 ihfB Integration host factor subunit beta Stenotrophomonas maltophilia (strain K279a)
B4SSV3 8.16e-17 72 36 1 90 3 ihfB Integration host factor subunit beta Stenotrophomonas maltophilia (strain R551-3)
Q9PAQ8 8.17e-17 72 35 1 90 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain 9a5c)
B2VC76 8.42e-17 71 35 1 88 3 ihfB Integration host factor subunit beta Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q2Y7A9 8.96e-17 71 35 1 90 3 ihfB Integration host factor subunit beta Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1D6D8 9.01e-17 72 37 0 89 3 ihfA Integration host factor subunit alpha Myxococcus xanthus (strain DK1622)
Q9K4Q3 9.01e-17 72 37 0 89 3 ihfA Integration host factor subunit alpha Myxococcus xanthus
C6DF68 9.05e-17 71 35 1 88 3 ihfB Integration host factor subunit beta Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D404 9.05e-17 71 35 1 88 3 ihfB Integration host factor subunit beta Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q47ZS6 9.67e-17 71 40 0 90 3 ihfA Integration host factor subunit alpha Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
B4UAP1 9.71e-17 72 37 0 89 3 ihfA Integration host factor subunit alpha Anaeromyxobacter sp. (strain K)
B8J836 9.71e-17 72 37 0 89 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IJA7 1.16e-16 71 37 0 89 3 ihfA Integration host factor subunit alpha Anaeromyxobacter dehalogenans (strain 2CP-C)
C3LNL8 1.26e-16 71 34 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain M66-2)
Q9KQT4 1.26e-16 71 34 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6Y4 1.26e-16 71 34 1 90 3 ihfB Integration host factor subunit beta Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7NYC0 1.45e-16 71 40 0 90 3 ihfA Integration host factor subunit alpha Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B5XY84 1.87e-16 70 36 1 88 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae (strain 342)
A6T704 1.91e-16 70 36 1 88 3 ihfB Integration host factor subunit beta Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7UMZ8 2.03e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z3K9 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Shigella sonnei (strain Ss046)
P0A6Y4 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Shigella flexneri
Q0SX03 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Shigella flexneri serotype 5b (strain 8401)
Q32E32 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Shigella dysenteriae serotype 1 (strain Sd197)
Q31YT8 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Shigella boydii serotype 4 (strain Sb227)
B2TUG9 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1RDU6 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli (strain UTI89 / UPEC)
B1LJV1 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Y4 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli (strain SE11)
B7NAR1 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6Y1 2.07e-16 70 34 1 88 1 ihfB Integration host factor subunit beta Escherichia coli (strain K12)
B1IW19 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6Y2 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TJE1 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZYL5 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O9:H4 (strain HS)
B1X852 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / DH10B)
C4ZQ38 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli (strain K12 / MC4100 / BW2952)
B7M841 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O8 (strain IAI1)
B7MS27 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O81 (strain ED1a)
B7NM62 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YT46 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6Y3 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O157:H7
B7LDA4 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli (strain 55989 / EAEC)
B7MHM1 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZK01 2.07e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia coli O139:H28 (strain E24377A / ETEC)
Q5P7Y1 2.08e-16 70 38 0 90 3 ihfA Integration host factor subunit alpha Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
C4LF00 2.11e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B8D7K1 2.14e-16 70 38 1 88 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57394 2.14e-16 70 38 1 88 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D999 2.14e-16 70 38 1 88 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A9MHX0 2.17e-16 70 36 1 88 3 ihfB Integration host factor subunit beta Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q2YBS0 2.25e-16 70 40 0 90 3 ihfA Integration host factor subunit alpha Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
C1D546 2.31e-16 70 37 1 90 3 ihfB Integration host factor subunit beta Laribacter hongkongensis (strain HLHK9)
A1SUQ7 2.34e-16 70 41 0 90 3 ihfA Integration host factor subunit alpha Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q3SK28 2.37e-16 70 40 0 90 3 ihfA Integration host factor subunit alpha Thiobacillus denitrificans (strain ATCC 25259)
Q82TD7 2.49e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A6T1G0 2.59e-16 70 36 1 90 3 ihfB Integration host factor subunit beta Janthinobacterium sp. (strain Marseille)
A4G858 2.59e-16 70 36 1 90 3 ihfB Integration host factor subunit beta Herminiimonas arsenicoxydans
B6EIY1 2.65e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Aliivibrio salmonicida (strain LFI1238)
Q0ADP0 2.72e-16 70 38 0 90 3 ihfA Integration host factor subunit alpha Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B7LN74 2.72e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q7W7C5 2.73e-16 70 40 0 90 3 ihfA Integration host factor subunit alpha Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WKR3 2.73e-16 70 40 0 90 3 ihfA Integration host factor subunit alpha Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P64394 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64395 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella typhi
B4TRU3 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella schwarzengrund (strain CVM19633)
B5BBP5 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella paratyphi A (strain AKU_12601)
C0PXU8 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella paratyphi C (strain RKS4594)
A9N7V2 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGG9 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T146 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella newport (strain SL254)
B4TD42 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella heidelberg (strain SL476)
B5R8J9 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZB6 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella enteritidis PT4 (strain P125109)
B5FQ55 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella dublin (strain CT_02021853)
Q57R19 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella choleraesuis (strain SC-B67)
B5F165 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Salmonella agona (strain SL483)
A8AIH1 2.75e-16 70 34 1 88 3 ihfB Integration host factor subunit beta Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7VVR6 2.82e-16 70 40 0 90 3 ihfA Integration host factor subunit alpha Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B5FG57 2.9e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain MJ11)
Q5E3Z3 2.9e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4VMF7 2.99e-16 70 35 1 90 3 ihfB Integration host factor subunit beta Stutzerimonas stutzeri (strain A1501)
Q7N6D2 3.1e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
P0A3I1 3.13e-16 70 40 1 90 3 ihfB Integration host factor subunit beta Rhizobium radiobacter
P0A3I2 3.13e-16 70 40 1 90 3 ihfB Integration host factor subunit beta Agrobacterium tumefaciens (strain 15955)
Q13EQ5 3.26e-16 70 37 1 90 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB5)
Q2J2G1 3.29e-16 70 37 1 90 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain HaA2)
P0A3H8 3.43e-16 73 41 1 89 3 hup2 DNA-binding protein HU 2 Streptomyces lividans
P0A3H7 3.43e-16 73 41 1 89 1 hup2 DNA-binding protein HU 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q7NTK9 3.44e-16 70 34 1 94 3 ihfB Integration host factor subunit beta Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q65TL4 3.51e-16 70 38 0 89 3 ihfA Integration host factor subunit alpha Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B6EN06 3.67e-16 70 40 0 90 3 ihfA Integration host factor subunit alpha Aliivibrio salmonicida (strain LFI1238)
Q9CML8 3.7e-16 70 35 1 90 3 ihfB Integration host factor subunit beta Pasteurella multocida (strain Pm70)
B5FDX6 3.75e-16 70 40 0 90 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain MJ11)
Q5E5G4 3.75e-16 70 40 0 90 3 ihfA Integration host factor subunit alpha Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4W8T1 4.18e-16 69 36 1 88 3 ihfB Integration host factor subunit beta Enterobacter sp. (strain 638)
P0A3H6 4.53e-16 69 40 1 91 3 hup1 DNA-binding protein HU 1 Streptomyces lividans
P0A3H5 4.53e-16 69 40 1 91 1 hup1 DNA-binding protein HU 1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q07MS0 4.75e-16 70 35 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisA53)
Q63S07 4.76e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain K96243)
A3NC29 4.76e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 668)
Q3JPY2 4.76e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 1710b)
A3NXW8 4.76e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia pseudomallei (strain 1106a)
A1V6M0 4.76e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain SAVP1)
Q62M28 4.76e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain ATCC 23344)
A2S4R7 4.76e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain NCTC 10229)
A3MHP1 4.76e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia mallei (strain NCTC 10247)
B6JGR8 4.81e-16 70 37 0 89 3 ihfA Integration host factor subunit alpha Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q9PFD5 4.84e-16 69 33 0 89 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain 9a5c)
Q2SY23 4.87e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q0AIZ2 5.05e-16 70 34 1 90 3 ihfB Integration host factor subunit beta Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B3Q602 5.09e-16 69 37 1 90 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain TIE-1)
Q6NDN9 5.09e-16 69 37 1 90 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q82VV7 5.28e-16 69 38 0 90 3 ihfA Integration host factor subunit alpha Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B8GRS4 5.45e-16 69 33 1 90 3 ihfB Integration host factor subunit beta Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q21YS7 5.76e-16 69 37 0 90 3 ihfA Integration host factor subunit alpha Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q214G0 5.87e-16 69 35 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisB18)
A6VP80 6.06e-16 69 38 0 89 3 ihfA Integration host factor subunit alpha Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q8Y0Y3 6.16e-16 70 35 1 90 3 ihfB Integration host factor subunit beta Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P37983 6.17e-16 69 34 1 88 3 ihfB Integration host factor subunit beta Dickeya dadantii (strain 3937)
Q5LV98 6.52e-16 69 36 1 90 3 ihfB Integration host factor subunit beta Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q87AB7 6.78e-16 69 33 0 89 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5D7 6.78e-16 69 33 0 89 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M12)
B2I9P2 6.78e-16 69 33 0 89 3 ihfA Integration host factor subunit alpha Xylella fastidiosa (strain M23)
Q136S3 8.03e-16 70 35 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain BisB5)
B6JCN9 8.18e-16 69 36 1 90 3 ihfB Integration host factor subunit beta Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q0AAM1 8.22e-16 69 38 0 90 3 ihfA Integration host factor subunit alpha Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2KZM3 8.33e-16 69 38 0 90 3 ihfA Integration host factor subunit alpha Bordetella avium (strain 197N)
B1JRD6 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CI5 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TN15 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pestis (strain Pestoides F)
Q1CGG8 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7I5 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGB1 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pestis
B2KA26 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CA70 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pestis bv. Antiqua (strain Antiqua)
A7FJW6 9.14e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q3SSS2 9.52e-16 69 35 0 89 3 ihfA Integration host factor subunit alpha Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1JMJ0 9.65e-16 68 34 1 88 3 ihfB Integration host factor subunit beta Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2IWQ7 9.87e-16 69 35 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain HaA2)
Q9RNZ5 1.01e-15 68 34 0 89 3 ihfA Integration host factor subunit alpha Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B3QJM1 1.02e-15 69 35 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain TIE-1)
Q6N676 1.02e-15 69 35 0 89 3 ihfA Integration host factor subunit alpha Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q1GK81 1.06e-15 68 35 1 90 3 ihfB Integration host factor subunit beta Ruegeria sp. (strain TM1040)
A9IJJ1 1.09e-15 69 35 1 90 3 ihfB Integration host factor subunit beta Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A5EKG4 1.11e-15 69 35 0 89 3 ihfA Integration host factor subunit alpha Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q87BJ8 1.18e-15 68 34 1 90 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6X0 1.18e-15 68 34 1 90 3 ihfB Integration host factor subunit beta Xylella fastidiosa (strain M23)
A4YW83 1.2e-15 69 35 0 89 3 ihfA Integration host factor subunit alpha Bradyrhizobium sp. (strain ORS 278)
A1B366 1.27e-15 68 35 0 89 3 ihfA Integration host factor subunit alpha Paracoccus denitrificans (strain Pd 1222)
C5BBR9 1.31e-15 68 34 1 88 3 ihfB Integration host factor subunit beta Edwardsiella ictaluri (strain 93-146)
Q28LB0 1.45e-15 68 36 1 90 3 ihfB Integration host factor subunit beta Jannaschia sp. (strain CCS1)
Q7W605 1.49e-15 68 35 1 90 3 ihfB Integration host factor subunit beta Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P23303 1.56e-15 68 34 1 88 3 ihfB Integration host factor subunit beta Serratia marcescens
Q3JBZ6 1.57e-15 68 37 0 90 3 ihfA Integration host factor subunit alpha Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q1QMY9 1.7e-15 68 35 0 89 3 ihfA Integration host factor subunit alpha Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q057N8 1.76e-15 68 33 1 90 3 ihfB Integration host factor subunit beta Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q07UH4 2.01e-15 68 36 1 90 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisA53)
A9ADV3 2.11e-15 68 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia multivorans (strain ATCC 17616 / 249)
Q12BQ7 2.14e-15 68 36 0 90 3 ihfA Integration host factor subunit alpha Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q1QS30 2.19e-15 68 36 1 90 3 ihfB Integration host factor subunit beta Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q46Y54 2.33e-15 68 34 1 90 3 ihfB Integration host factor subunit beta Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q15SX9 2.5e-15 67 35 0 90 3 ihfA Integration host factor subunit alpha Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q6F874 2.6e-15 67 37 0 89 3 ihfA Integration host factor subunit alpha Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q057Y8 2.66e-15 68 37 0 89 3 ihfA Integration host factor subunit alpha Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B0V5Q4 2.67e-15 67 37 0 89 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AYE)
A3M2B0 2.67e-15 67 37 0 89 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VV83 2.67e-15 67 37 0 89 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain SDF)
B2HTI2 2.67e-15 67 37 0 89 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain ACICU)
B7I698 2.67e-15 67 37 0 89 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AB0057)
B7GZZ4 2.67e-15 67 37 0 89 3 ihfA Integration host factor subunit alpha Acinetobacter baumannii (strain AB307-0294)
A7IHH0 2.72e-15 67 35 1 90 3 ihfB Integration host factor subunit beta Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B8EMZ0 2.83e-15 67 36 1 90 3 ihfB Integration host factor subunit beta Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q5GXY6 3.33e-15 67 34 0 90 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P101 3.33e-15 67 34 0 90 3 ihfA Integration host factor subunit alpha Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BRU3 3.33e-15 67 34 0 90 3 ihfA Integration host factor subunit alpha Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P0A0T9 3.33e-15 67 34 0 90 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RRH5 3.33e-15 67 34 0 90 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain B100)
Q4UW51 3.33e-15 67 34 0 90 3 ihfA Integration host factor subunit alpha Xanthomonas campestris pv. campestris (strain 8004)
P0A0U0 3.33e-15 67 34 0 90 3 ihfA Integration host factor subunit alpha Xanthomonas axonopodis pv. citri (strain 306)
Q9CN18 3.82e-15 67 37 0 89 3 ihfA Integration host factor subunit alpha Pasteurella multocida (strain Pm70)
Q39IF8 3.84e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EB39 3.84e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BY25 4.1e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia orbicola (strain AU 1054)
B1JXS2 4.1e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia orbicola (strain MC0-3)
A0K5M4 4.1e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia cenocepacia (strain HI2424)
Q3SWL5 4.25e-15 67 36 1 90 3 ihfB Integration host factor subunit beta Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B2JF07 4.47e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A8GCH4 4.58e-15 67 36 2 90 3 ihfB Integration host factor subunit beta Serratia proteamaculans (strain 568)
C3LLR8 4.7e-15 67 38 0 90 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain M66-2)
Q9KSN4 4.7e-15 67 38 0 90 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1W7 4.7e-15 67 38 0 90 3 ihfA Integration host factor subunit alpha Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A4JCH7 5.04e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BH90 5.04e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YV36 5.04e-15 67 34 1 90 3 ihfB Integration host factor subunit beta Burkholderia ambifaria (strain MC40-6)
Q2NUA6 5.11e-15 67 34 1 88 3 ihfB Integration host factor subunit beta Sodalis glossinidius (strain morsitans)
B9KU92 5.15e-15 67 36 1 90 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A3PPV4 5.15e-15 67 36 1 90 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q9X4E2 5.38e-15 67 36 1 90 3 ihfB Integration host factor subunit beta Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q2RTS7 5.53e-15 67 36 0 86 3 ihfA Integration host factor subunit alpha Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q83C16 5.56e-15 67 40 0 90 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N8J9 5.56e-15 67 40 0 90 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KGB5 5.56e-15 67 40 0 90 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain Dugway 5J108-111)
B6IZG2 5.56e-15 67 40 0 90 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain CbuG_Q212)
B6J7X5 5.56e-15 67 40 0 90 3 ihfA Integration host factor subunit alpha Coxiella burnetii (strain CbuK_Q154)
Q1QWK1 5.6e-15 67 37 0 90 3 ihfA Integration host factor subunit alpha Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8XZ23 5.82e-15 67 37 0 86 3 ihfA Integration host factor subunit alpha Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q89WE8 6.22e-15 67 36 1 90 3 ihfB Integration host factor subunit beta Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B0UUH4 6.86e-15 66 34 1 90 3 ihfB Integration host factor subunit beta Histophilus somni (strain 2336)
Q0I390 6.86e-15 66 34 1 90 3 ihfB Integration host factor subunit beta Histophilus somni (strain 129Pt)
Q98GS0 7.01e-15 66 37 1 90 3 ihfB Integration host factor subunit beta Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
B6IUP4 7.22e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Rhodospirillum centenum (strain ATCC 51521 / SW)
A4YJI9 8.36e-15 67 36 1 90 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain ORS 278)
Q47GF4 8.45e-15 66 34 0 90 3 ihfA1 Integration host factor subunit alpha 1 Dechloromonas aromatica (strain RCB)
A6VYH5 8.64e-15 66 42 1 85 3 ihfA Integration host factor subunit alpha Marinomonas sp. (strain MWYL1)
Q8G304 8.81e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Brucella suis biovar 1 (strain 1330)
B0CIR1 8.81e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VN89 8.81e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9M798 8.81e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A6WV92 8.81e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q161H6 9e-15 66 35 1 90 3 ihfB Integration host factor subunit beta Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B0CLA3 9.37e-15 66 34 0 89 3 ihfA Integration host factor subunit alpha Brucella suis (strain ATCC 23445 / NCTC 10510)
Q57FM3 9.41e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Brucella abortus biovar 1 (strain 9-941)
Q2YP18 9.41e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Brucella abortus (strain 2308)
B2S8E6 9.41e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Brucella abortus (strain S19)
Q63TM8 9.67e-15 67 38 0 86 3 ihfA Integration host factor subunit alpha Burkholderia pseudomallei (strain K96243)
Q21CB6 9.72e-15 66 36 1 90 3 ihfB Integration host factor subunit beta Rhodopseudomonas palustris (strain BisB18)
Q6MMJ0 9.76e-15 66 37 0 86 3 ihfA Integration host factor subunit alpha Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q2RXP8 1.06e-14 66 38 1 88 3 ihfB Integration host factor subunit beta Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q5QXL9 1.06e-14 66 36 0 90 3 ihfA Integration host factor subunit alpha Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B0BP19 1.07e-14 66 36 1 90 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GXH5 1.07e-14 66 36 1 90 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0A3 1.07e-14 66 36 1 90 3 ihfB Integration host factor subunit beta Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q0VNG4 1.07e-14 66 37 0 90 3 ihfA Integration host factor subunit alpha Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5E8A7 1.19e-14 66 36 1 90 3 ihfB Integration host factor subunit beta Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B4ETL2 1.43e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Proteus mirabilis (strain HI4320)
B9JZH2 1.61e-14 65 36 1 90 3 ihfB Integration host factor subunit beta Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q1LQG7 1.69e-14 67 33 1 90 3 ihfB Integration host factor subunit beta Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7VLR8 1.71e-14 65 37 1 90 3 ihfB Integration host factor subunit beta Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1WU59 1.77e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Halorhodospira halophila (strain DSM 244 / SL1)
C6DFZ2 1.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D4H4 1.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P43723 1.88e-14 65 35 0 90 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q4QKM2 1.88e-14 65 35 0 90 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain 86-028NP)
B2FN73 1.92e-14 65 33 0 90 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain K279a)
B4SQG8 1.92e-14 65 33 0 90 3 ihfA Integration host factor subunit alpha Stenotrophomonas maltophilia (strain R551-3)
Q2NT26 1.93e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Sodalis glossinidius (strain morsitans)
P37982 1.98e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Dickeya dadantii (strain 3937)
Q2W4R6 2e-14 65 34 0 89 3 ihfA Integration host factor subunit alpha Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q06607 2.04e-14 65 36 1 90 1 ihfB Integration host factor subunit beta Rhodobacter capsulatus
B2VEL2 2.07e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q21KD4 2.13e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A8I5K8 2.13e-14 65 33 0 89 3 ihfA Integration host factor subunit alpha Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P17615 2.24e-14 65 39 0 89 1 hup DNA-binding protein HB1 Bifidobacterium longum (strain NCC 2705)
Q7MK44 2.28e-14 65 38 0 90 3 ihfA Integration host factor subunit alpha Vibrio vulnificus (strain YJ016)
Q8DA35 2.28e-14 65 38 0 90 3 ihfA Integration host factor subunit alpha Vibrio vulnificus (strain CMCP6)
B1J6V0 2.39e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain W619)
P0A127 2.39e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida
P0A126 2.39e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKR2 2.39e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain GB-1)
A5W5D5 2.39e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A9C3C8 2.86e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Delftia acidovorans (strain DSM 14801 / SPH-1)
Q7N3Q2 2.86e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1KUD0 2.91e-14 65 32 1 95 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0U2 2.91e-14 65 32 1 95 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0U1 2.91e-14 65 32 1 95 3 ihfB Integration host factor subunit beta Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0A0U3 2.91e-14 65 32 1 95 3 ihfB Integration host factor subunit beta Neisseria gonorrhoeae
Q8YET3 2.92e-14 65 36 1 90 3 ihfB Integration host factor subunit beta Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RGK7 2.92e-14 65 36 1 90 3 ihfB Integration host factor subunit beta Brucella melitensis biotype 2 (strain ATCC 23457)
Q87Q56 3.19e-14 65 37 0 90 3 ihfA Integration host factor subunit alpha Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P30787 3.24e-14 65 32 0 89 1 ihfA Integration host factor subunit alpha Rhodobacter capsulatus
A8GDR1 3.29e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Serratia proteamaculans (strain 568)
A8LLT5 3.36e-14 65 33 0 89 3 ihfA Integration host factor subunit alpha Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A7MVH4 3.37e-14 65 37 0 90 3 ihfA Integration host factor subunit alpha Vibrio campbellii (strain ATCC BAA-1116)
A1B8K9 3.45e-14 65 34 1 90 3 ihfB Integration host factor subunit beta Paracoccus denitrificans (strain Pd 1222)
A8A0Q4 3.49e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O9:H4 (strain HS)
C5B852 3.52e-14 65 37 0 90 3 ihfA Integration host factor subunit alpha Edwardsiella ictaluri (strain 93-146)
Q3IIL3 3.6e-14 65 35 0 89 3 ihfA Integration host factor subunit alpha Pseudoalteromonas translucida (strain TAC 125)
B1JJ23 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q9X9F6 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TIL7 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pestis (strain Pestoides F)
Q1CIH0 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0A2 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Angola)
Q8ZDX2 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pestis
B2K662 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C735 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pestis bv. Antiqua (strain Antiqua)
A7FHG7 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JMM4 3.63e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q11J82 3.64e-14 65 33 0 89 3 ihfA Integration host factor subunit alpha Chelativorans sp. (strain BNC1)
A5EXT4 3.71e-14 65 34 0 89 3 ihfA Integration host factor subunit alpha Dichelobacter nodosus (strain VCS1703A)
Q3Z260 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Shigella sonnei (strain Ss046)
P0A6Y0 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Shigella flexneri
Q0T4S2 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Shigella flexneri serotype 5b (strain 8401)
Q32FI7 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Shigella dysenteriae serotype 1 (strain Sd197)
Q321K4 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Shigella boydii serotype 4 (strain Sb227)
B2U390 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LQ77 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RB83 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain UTI89 / UPEC)
B1LE18 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain SMS-3-5 / SECEC)
B6I8Q5 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain SE11)
B7N550 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A6X7 3.76e-14 65 36 0 90 1 ihfA Integration host factor subunit alpha Escherichia coli (strain K12)
B1IPL5 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A6X8 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0THB6 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XG19 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain K12 / DH10B)
C4ZYH4 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1C1 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O8 (strain IAI1)
B7MVJ1 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O81 (strain ED1a)
B7NT64 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQ00 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A6X9 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O157:H7
B7L6I5 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli (strain 55989 / EAEC)
B7MAS3 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O45:K1 (strain S88 / ExPEC)
B7US95 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZMI0 3.76e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Escherichia coli O139:H28 (strain E24377A / ETEC)
P23302 3.81e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Serratia marcescens
P0A1S0 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1S1 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella typhi
B4TUF6 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella schwarzengrund (strain CVM19633)
B5BA36 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain AKU_12601)
C0Q640 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella paratyphi C (strain RKS4594)
A9N236 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PH86 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4N4 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella newport (strain SL254)
B4TGH7 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella heidelberg (strain SL476)
B5RAW7 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVW2 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella enteritidis PT4 (strain P125109)
B5FJA2 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella dublin (strain CT_02021853)
Q57PU7 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella choleraesuis (strain SC-B67)
B5F7F6 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella agona (strain SL483)
A6TAI1 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XQD2 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Klebsiella pneumoniae (strain 342)
A8AHA5 3.85e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q12NT8 3.89e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9MFB7 3.93e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A7MNY7 3.93e-14 65 36 0 90 3 ihfA Integration host factor subunit alpha Cronobacter sakazakii (strain ATCC BAA-894)
Q083K5 4.02e-14 65 35 0 90 3 ihfA Integration host factor subunit alpha Shewanella frigidimarina (strain NCIMB 400)
A5UF06 4.03e-14 64 35 0 90 3 ihfA Integration host factor subunit alpha Haemophilus influenzae (strain PittGG)
A4W9M9 4.15e-14 64 36 0 90 3 ihfA Integration host factor subunit alpha Enterobacter sp. (strain 638)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18180
Feature type CDS
Gene hupA
Product nucleoid-associated protein HU-alpha
Location 34284 - 34556 (strand: 1)
Length 273 (nucleotides) / 90 (amino acids)
In genomic island -

Contig

Accession ZDB_235
Length 38736 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_486
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00216 Bacterial DNA-binding protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0776 Replication, recombination and repair (L) L Bacterial nucleoid DNA-binding protein IHF-alpha

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05787 DNA-binding protein HU-alpha - -

Protein Sequence

MNKTQLIDAIAEKAELSKAQAKAALESTLAAITDSLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFTAGKALKDSVK

Flanking regions ( +/- flanking 50bp)

CCGACGCACTCGATGCTTTGCAAACGATAAACACACTGTAAGGATATTTTATGAATAAGACTCAATTGATTGATGCTATCGCAGAAAAAGCAGAGCTGTCTAAAGCACAAGCTAAAGCAGCGCTGGAATCAACTCTGGCGGCCATCACTGACTCTCTGAAAGAAGGCGATGCTGTACAATTAGTTGGCTTCGGTACTTTTAAAGTTAACCATCGTGCAGAGCGTACTGGCCGTAACCCGCAGACCGGTAAAGAAATCAAAATTGCAGCAGCAAACGTGCCTGCTTTCACTGCCGGTAAAGCACTGAAAGATTCAGTAAAATAATTGCGTTGCAAAAACAGATTGATAGAGGGGGATTTCGTCCCCTTTTGTTG