Homologs in group_1673

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11630 FBDBKF_11630 100.0 Morganella morganii S1 marR DNA-binding transcriptional regulator, MarR family
NLDBIP_18760 NLDBIP_18760 100.0 Morganella morganii S4 marR DNA-binding transcriptional regulator, MarR family
LHKJJB_17990 LHKJJB_17990 100.0 Morganella morganii S3 marR DNA-binding transcriptional regulator, MarR family
HKOGLL_18660 HKOGLL_18660 100.0 Morganella morganii S5 marR DNA-binding transcriptional regulator, MarR family
F4V73_RS08050 F4V73_RS08050 94.3 Morganella psychrotolerans - MarR family transcriptional regulator
PMI_RS08980 PMI_RS08980 60.0 Proteus mirabilis HI4320 - MarR family transcriptional regulator

Distribution of the homologs in the orthogroup group_1673

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1673

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P62088 1.63e-08 53 30 0 91 4 prsX HTH-type transcriptional regulator PrsX Escherichia coli
P62089 1.63e-08 53 30 0 91 4 prsX HTH-type transcriptional regulator PrsX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42193 4.11e-08 52 28 1 107 4 papX HTH-type transcriptional regulator PapX Escherichia coli
O31592 4.91e-07 49 29 2 116 4 yhbI Uncharacterized HTH-type transcriptional regulator YhbI Bacillus subtilis (strain 168)
P0ACR9 8.91e-07 49 30 0 91 2 mprA Transcriptional repressor MprA Escherichia coli (strain K12)
P0ACS0 8.91e-07 49 30 0 91 3 mprA Transcriptional repressor MprA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACS1 8.91e-07 49 30 0 91 3 mprA Transcriptional repressor MprA Escherichia coli O157:H7
O31564 2.79e-05 44 34 1 85 4 yfiV Uncharacterized HTH-type transcriptional regulator YfiV Bacillus subtilis (strain 168)
P97247 3.53e-05 44 25 0 101 4 ysmB Uncharacterized HTH-type transcriptional regulator YsmB Bacillus subtilis (strain 168)
O34949 3.71e-05 44 26 0 99 4 ykoM Uncharacterized HTH-type transcriptional regulator YkoM Bacillus subtilis (strain 168)
O33817 6.91e-05 43 26 0 102 4 None Putative transcriptional regulatory protein for hcr operon Thauera aromatica
P0A2T4 0.000343 41 28 0 71 4 marR Multiple antibiotic resistance protein MarR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T5 0.000343 41 28 0 71 3 marR Multiple antibiotic resistance protein MarR Salmonella typhi
P42195 0.000377 41 23 1 113 4 pecS HTH-type transcriptional regulator PecS Dickeya dadantii (strain 3937)
P25150 0.000785 40 22 0 114 4 ywaE Uncharacterized HTH-type transcriptional regulator YwaE Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17550
Feature type CDS
Gene marR
Product DNA-binding transcriptional regulator, MarR family
Location 20204 - 20626 (strand: -1)
Length 423 (nucleotides) / 140 (amino acids)

Contig

Accession ZDB_233
Length 42053 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1673
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01047 MarR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1846 Transcription (K) K DNA-binding transcriptional regulator, MarR family

Protein Sequence

MSFKELENTLSLLQCTLVAQRTICSPEKVTWAQYDVMEMLRLQGDLTPSDLSQKLGISRQNVSKSLRALKKHQFVSQYQSETDKRELVTQLTPEGEEFLSRAATGRTRNAEKVFASLNDDEQRQFRILSRKVIDALTRDQ

Flanking regions ( +/- flanking 50bp)

CTGATTTTGCCTTTCGGCTAAACTAAGGGGGAGGATAAAAGGGAGGTGTTATGTCATTCAAGGAACTGGAAAATACACTGTCATTGTTACAGTGCACATTGGTAGCGCAACGGACCATCTGCTCACCTGAAAAGGTGACGTGGGCACAGTATGACGTAATGGAAATGTTGCGCCTTCAGGGGGATTTAACCCCGTCGGATTTAAGCCAGAAACTCGGGATTTCGCGCCAGAATGTCTCGAAATCATTACGGGCGCTGAAAAAACACCAGTTTGTTTCCCAGTATCAGTCGGAGACCGATAAACGGGAACTGGTTACCCAGCTGACACCGGAAGGTGAAGAGTTTCTGTCCCGCGCGGCGACAGGACGCACCCGCAATGCAGAAAAAGTATTTGCAAGTCTGAATGACGATGAACAGCGCCAGTTTCGTATACTGAGCCGGAAAGTTATCGATGCACTGACCCGGGATCAGTGAGCGGGACGTTTAAGCGGTTTTATCAGGCCACTTAAACCTTCGGTTTTAAT