Homologs in group_339

Help

7 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11600 FBDBKF_11600 100.0 Morganella morganii S1 ptsH phosphocarrier protein Hpr
NLDBIP_18730 NLDBIP_18730 100.0 Morganella morganii S4 ptsH phosphocarrier protein Hpr
LHKJJB_17960 LHKJJB_17960 100.0 Morganella morganii S3 ptsH phosphocarrier protein Hpr
HKOGLL_18690 HKOGLL_18690 100.0 Morganella morganii S5 ptsH phosphocarrier protein Hpr
F4V73_RS08080 F4V73_RS08080 98.8 Morganella psychrotolerans ptsH phosphocarrier protein Hpr
PMI_RS09020 PMI_RS09020 90.6 Proteus mirabilis HI4320 ptsH phosphocarrier protein Hpr
PMI_RS11895 PMI_RS11895 36.5 Proteus mirabilis HI4320 dhaM dihydroxyacetone kinase phosphoryl donor subunit DhaM

Distribution of the homologs in the orthogroup group_339

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_339

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AA09 2.41e-50 155 90 0 85 3 ptsH Phosphocarrier protein HPr Shigella flexneri
P0AA07 2.41e-50 155 90 0 85 1 ptsH Phosphocarrier protein HPr Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA08 2.41e-50 155 90 0 85 3 ptsH Phosphocarrier protein HPr Salmonella typhi
P0AA04 2.41e-50 155 90 0 85 1 ptsH Phosphocarrier protein HPr Escherichia coli (strain K12)
P0AA05 2.41e-50 155 90 0 85 3 ptsH Phosphocarrier protein HPr Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA06 2.41e-50 155 90 0 85 3 ptsH Phosphocarrier protein HPr Escherichia coli O157:H7
P16481 7e-50 154 89 0 85 3 ptsH Phosphocarrier protein HPr Klebsiella pneumoniae
P43921 6.27e-42 134 76 0 85 3 ptsH Phosphocarrier protein HPr Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9KTD6 3.23e-39 127 75 0 84 1 ptsH Phosphocarrier protein HPr Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9WXI5 3.99e-38 125 67 0 85 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8KA49 4.61e-36 119 64 0 85 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89B03 1.46e-32 110 61 0 85 3 ptsH Phosphocarrier protein HPr Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O51507 1.92e-24 90 54 0 81 3 ptsH Phosphocarrier protein HPr Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
O06976 5.91e-19 76 49 0 77 1 crh HPr-like protein Crh Bacillus subtilis (strain 168)
O69250 7.93e-16 68 41 0 81 1 ptsH Phosphocarrier protein HPr Priestia megaterium
Q9K708 9.51e-16 68 39 0 81 3 crh HPr-like protein Crh Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9K8D2 2.99e-15 67 42 1 82 3 ptsH Phosphocarrier protein HPr Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q84F84 7.26e-15 66 41 0 84 1 ptsH Phosphocarrier protein HPr Lysinibacillus sphaericus
P24366 7.73e-15 66 41 0 81 1 ptsH Phosphocarrier protein HPr Streptococcus salivarius
O07125 2.81e-14 64 39 0 81 3 ptsH Phosphocarrier protein HPr Latilactobacillus sakei
Q9ZAD9 6.3e-14 63 41 0 81 3 ptsH Phosphocarrier protein HPr Lactococcus lactis subsp. cremoris
P07515 2.38e-13 62 40 0 79 1 ptsH Phosphocarrier protein HPr Enterococcus faecalis (strain ATCC 700802 / V583)
Q9CJ83 3.02e-13 62 40 0 81 1 ptsH Phosphocarrier protein HPr Lactococcus lactis subsp. lactis (strain IL1403)
Q87DQ0 3.61e-13 62 37 0 80 3 ptsH Phosphocarrier protein HPr Xylella fastidiosa (strain Temecula1 / ATCC 700964)
P08877 3.93e-13 62 35 0 81 1 ptsH Phosphocarrier protein HPr Bacillus subtilis (strain 168)
Q9KJV3 5.94e-13 61 46 0 67 1 ptsH Phosphocarrier protein HPr Lacticaseibacillus casei
P23534 6.21e-13 61 37 0 81 1 ptsH Phosphocarrier protein HPr Staphylococcus carnosus
Q9WXK8 8.31e-13 61 46 0 67 1 ptsH Phosphocarrier protein HPr Streptococcus equinus
P44715 1.52e-12 64 48 1 76 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P44715 5e-07 48 37 1 66 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P45596 1.8e-12 60 46 0 67 1 ptsH Phosphocarrier protein HPr Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9PDH6 2.15e-12 60 36 0 80 3 ptsH Phosphocarrier protein HPr Xylella fastidiosa (strain 9a5c)
Q9EYQ9 2.73e-12 59 35 0 81 1 ptsH Phosphocarrier protein HPr Staphylococcus xylosus
P0A438 6.6e-12 58 33 0 81 3 ptsH Phosphocarrier protein HPr Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A439 6.6e-12 58 33 0 81 3 ptsH Phosphocarrier protein HPr Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P0A0E2 1.61e-11 57 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MW2)
P0A0E3 1.61e-11 57 34 0 81 1 ptsH Phosphocarrier protein HPr Staphylococcus aureus
Q6GAD1 1.61e-11 57 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MSSA476)
Q6GI02 1.61e-11 57 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain MRSA252)
P99143 1.61e-11 57 34 0 81 1 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain N315)
P0A0E1 1.61e-11 57 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH02 1.61e-11 57 34 0 81 3 ptsH Phosphocarrier protein HPr Staphylococcus aureus (strain COL)
P75061 2.9e-11 57 38 1 75 1 ptsH Phosphocarrier protein HPr Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P45611 3.69e-11 57 36 0 74 1 ptsH Phosphocarrier protein HPr Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
P23388 1.09e-10 59 46 0 63 3 fruB(HI) Multiphosphoryl transfer protein Rhodobacter capsulatus
Q9F166 1.32e-10 55 37 0 67 1 ptsH Phosphocarrier protein HPr Bacillus thuringiensis subsp. israelensis
P23537 2.05e-10 55 33 0 81 3 phbH Phosphocarrier protein HPr Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P45597 1.12e-09 56 37 0 80 3 fruB Multiphosphoryl transfer protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P47287 2.93e-09 52 34 1 75 3 ptsH Phosphocarrier protein HPr Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
P65877 1.61e-08 50 30 0 81 3 ptsH Phosphocarrier protein HPr Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P65876 1.61e-08 50 30 0 81 3 ptsH Phosphocarrier protein HPr Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0DN88 2.63e-08 52 38 0 70 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Providencia stuartii (strain MRSN 2154)
D4GYE3 4.17e-08 49 30 1 81 2 ptsH1 Phosphocarrier protein HPr Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P17127 1.1e-07 50 35 1 76 1 fruB Multiphosphoryl transfer protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z591 1.16e-07 50 35 1 76 3 fruB Multiphosphoryl transfer protein Salmonella typhi
P69811 1.32e-07 50 36 1 74 1 fruB Multiphosphoryl transfer protein Escherichia coli (strain K12)
P69812 1.32e-07 50 36 1 74 3 fruB Multiphosphoryl transfer protein Escherichia coli O157:H7
O50515 2.4e-07 47 30 1 84 1 ptsH Phosphocarrier protein HPr Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KM70 3.42e-07 49 39 1 73 2 fruB Multiphosphoryl transfer protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9S0K8 5.65e-07 46 32 0 80 3 ptsO Phosphocarrier protein NPr Shewanella violacea (strain JCM 10179 / CIP 106290 / LMG 19151 / DSS12)
Q9ZA86 1.18e-06 45 33 1 78 3 ptsO Phosphocarrier protein NPr Proteus mirabilis (strain HI4320)
Q9KP46 3.2e-06 44 35 1 79 3 npr Phosphocarrier protein NPr Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P42013 3.74e-06 43 31 0 63 1 ptsH Phosphocarrier protein HPr Geobacillus stearothermophilus
Q9HVV2 1.22e-05 42 33 1 78 3 ptsH Phosphocarrier protein HPr Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9Z426 1.53e-05 42 31 1 85 3 ptsH Phosphocarrier protein HPr Pseudomonas putida
P37349 2.61e-05 43 30 0 69 1 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Escherichia coli (strain K12)
O83598 5.58e-05 41 30 0 80 3 ptsH Phosphocarrier protein HPr Treponema pallidum (strain Nichols)
D4GL26 0.000236 41 30 0 78 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Pantoea ananatis (strain LMG 20103)
Q9PK56 0.000434 38 27 0 74 3 ptsH Phosphocarrier protein HPr Chlamydia muridarum (strain MoPn / Nigg)
A0A0H3H456 0.000507 40 33 0 62 3 dhaM PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM Klebsiella michiganensis (strain ATCC 8724 / DSM 4798 / JCM 20051 / NBRC 3318 / NRRL B-199 / KCTC 1686 / BUCSAV 143 / CCM 1901)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17520
Feature type CDS
Gene ptsH
Product phosphocarrier protein Hpr
Location 14194 - 14451 (strand: -1)
Length 258 (nucleotides) / 85 (amino acids)

Contig

Accession ZDB_233
Length 42053 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_339
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00381 PTS HPr component phosphorylation site

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1925 Signal transduction mechanisms (T)
Carbohydrate transport and metabolism (G)
TG HPr or related phosphotransfer protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02784 phosphocarrier protein HPr Phosphotransferase system (PTS) -

Protein Sequence

MYQQEVTITAPNGLHTRPAAQFVKEAKTFASDITLTSGGKSASAKSLFKLQTLGLTQGTVVTIAAEGEDEQKAVEHLVKLMGELE

Flanking regions ( +/- flanking 50bp)

ATGTCTTAATATTAACCGCCGATAAAAAATTCCAAACATGAGGTAATGCTATGTATCAGCAAGAAGTCACCATTACTGCACCTAACGGTCTGCACACCCGTCCTGCGGCTCAGTTTGTCAAAGAAGCCAAAACTTTCGCTTCTGACATCACCCTGACTTCCGGCGGCAAAAGCGCCAGCGCCAAAAGCCTGTTCAAGTTACAGACTCTGGGTCTGACACAGGGCACCGTGGTGACTATCGCCGCAGAAGGTGAAGATGAGCAGAAAGCAGTAGAGCACCTCGTCAAACTGATGGGTGAACTGGAGTAATCTCCTTCCGCCCTCACCTGTCAGGATCCCCGGCCACCGTCTCATGCCGG