Homologs in group_3089

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18895 FBDBKF_18895 100.0 Morganella morganii S1 cbiE cobalt-precorrin-7 (C(5))-methyltransferase
NLDBIP_18470 NLDBIP_18470 100.0 Morganella morganii S4 cbiE cobalt-precorrin-7 (C(5))-methyltransferase
LHKJJB_09155 LHKJJB_09155 100.0 Morganella morganii S3 cbiE cobalt-precorrin-7 (C(5))-methyltransferase
HKOGLL_08705 HKOGLL_08705 100.0 Morganella morganii S5 cbiE cobalt-precorrin-7 (C(5))-methyltransferase
F4V73_RS13700 F4V73_RS13700 82.3 Morganella psychrotolerans - cobalt-precorrin-7 (C(5))-methyltransferase

Distribution of the homologs in the orthogroup group_3089

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3089

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A2H1 5.16e-67 207 50 2 201 1 cbiE Cobalt-precorrin-7 C(5)-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2H2 5.16e-67 207 50 2 201 3 cbiE Cobalt-precorrin-7 C(5)-methyltransferase Salmonella typhi
O87694 9.41e-24 100 33 6 205 1 cbiET Cobalamin biosynthesis bifunctional protein CbiET Priestia megaterium
Q58917 4.13e-19 84 26 6 207 3 cbiE Probable cobalt-precorrin-7 C(5)-methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P21921 3.33e-16 79 32 4 183 1 cobL Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] Sinorhizobium sp.
Q9HZU0 2.8e-07 53 24 7 211 3 cobL Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O87689 1.37e-06 51 25 5 152 1 cbiH60 Cobalt-factor III methyltransferase Priestia megaterium
O29534 1.15e-05 48 24 2 118 3 cbiHC Cobalamin biosynthesis protein CbiHC Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
O19889 1.92e-05 47 28 4 125 3 cobA Uroporphyrinogen-III C-methyltransferase Cyanidium caldarium
O27454 2.28e-05 47 22 3 129 3 cbiH Probable cobalt-factor III C(17)-methyltransferase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q58223 6.75e-05 45 23 4 135 3 cbiH Probable cobalt-factor III C(17)-methyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A9LZ77 7.59e-05 46 27 6 165 3 cysG Siroheme synthase Neisseria meningitidis serogroup C (strain 053442)
P95370 7.61e-05 46 27 6 164 3 cysG Siroheme synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q0AHC1 8.08e-05 46 29 5 129 3 cysG Siroheme synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1KU10 8.27e-05 46 27 6 165 3 cysG Siroheme synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q3ILQ9 8.45e-05 46 22 7 203 3 cysG Siroheme synthase Pseudoalteromonas translucida (strain TAC 125)
P57001 9.01e-05 45 27 6 164 3 cysG Siroheme synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q05593 0.000105 45 26 8 209 1 cbiL Cobalt-precorrin-2 C(20)-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P9WGA9 0.000157 45 23 6 221 1 cobL Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q2Y6L7 0.000188 45 26 9 200 3 cysG Siroheme synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A4SHL4 0.000238 44 26 7 165 3 cysG1 Siroheme synthase 1 Aeromonas salmonicida (strain A449)
P9WGA8 0.000271 44 23 5 202 3 cobL Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q3JCS0 0.000318 44 26 2 128 3 cysG Siroheme synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0VQ05 0.000484 43 23 8 184 3 cysG Siroheme synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1WWP8 0.000597 43 26 4 145 3 cysG1 Siroheme synthase 1 Halorhodospira halophila (strain DSM 244 / SL1)
A5CXE4 0.000671 43 27 4 128 3 cysG Siroheme synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A7MKK9 0.000788 43 26 6 162 3 cysG2 Siroheme synthase 2 Cronobacter sakazakii (strain ATCC BAA-894)
A0KQJ4 0.000863 43 23 5 163 3 cysG3 Siroheme synthase 3 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17090
Feature type CDS
Gene cbiE
Product cobalt-precorrin-7 (C(5))-methyltransferase
Location 22563 - 23174 (strand: -1)
Length 612 (nucleotides) / 203 (amino acids)

Contig

Accession ZDB_231
Length 52966 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3089
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00590 Tetrapyrrole (Corrin/Porphyrin) Methylases

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2241 Coenzyme transport and metabolism (H) H Precorrin-6B methylase 1

Kegg Ortholog Annotation(s)

Protein Sequence

MIYVTGVGPGSEAYLTRRAADVISGADILIGGQRHLDEFAGLTTETRVIDADISGLMNWIAERLDRRIVILASGDPMFFGIGKRISETFAPEQVQIVPGISSVQYLCSRAGMDMNDIYLTSSHNRSPDFDWLLAHERIGMVTDSKIGPKEIAAEIRQRGQTRRMIIGENLSGRNERITILNAEEVSGDYNMNVVLIDKRGSVA

Flanking regions ( +/- flanking 50bp)

CAGGTGCTGGGGACCAACCGGCCGCTCAGCGCCATAACGGAGGGATTCCGATGATTTATGTGACAGGTGTGGGCCCCGGCTCAGAAGCGTATCTGACCCGGCGGGCAGCGGATGTGATTTCCGGGGCGGACATTTTAATCGGCGGTCAGCGCCATCTGGATGAATTTGCAGGGCTGACCACAGAAACCCGTGTCATTGATGCGGATATCAGCGGCCTGATGAACTGGATAGCAGAGCGTCTTGATCGCCGCATTGTCATTCTGGCTTCCGGTGACCCGATGTTTTTCGGCATCGGCAAACGCATCAGCGAAACCTTCGCACCGGAGCAGGTTCAGATAGTGCCGGGTATCAGCTCCGTACAATATCTGTGTTCCCGTGCGGGGATGGATATGAATGATATTTATCTCACCAGCAGCCACAACCGCAGCCCGGATTTTGACTGGCTGCTCGCCCATGAGCGTATCGGCATGGTGACGGACAGTAAGATCGGCCCGAAAGAAATCGCTGCCGAAATCCGGCAGCGCGGCCAGACCCGGCGGATGATCATCGGAGAAAACCTCTCCGGCCGGAATGAGCGGATCACCATTCTCAATGCAGAAGAGGTCAGCGGTGATTACAACATGAATGTGGTGTTAATTGATAAGCGGGGCAGCGTGGCCTGATGAAAGACGAACTGTTTTTACGCGGGCAGCAGATCCCGATGACCAAAGAG