Homologs in group_3088

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18890 FBDBKF_18890 100.0 Morganella morganii S1 cbiT decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
NLDBIP_18465 NLDBIP_18465 100.0 Morganella morganii S4 cbiT decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
LHKJJB_09160 LHKJJB_09160 100.0 Morganella morganii S3 cbiT decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
HKOGLL_08710 HKOGLL_08710 100.0 Morganella morganii S5 cbiT decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
F4V73_RS13705 F4V73_RS13705 89.9 Morganella psychrotolerans - decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase

Distribution of the homologs in the orthogroup group_3088

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3088

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q05632 1.17e-74 225 57 0 185 1 cbiT Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z5M9 1.6e-74 225 57 0 185 3 cbiT Cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Salmonella typhi
Q96ZL5 1.99e-27 105 34 4 186 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q97WC7 2.42e-27 105 33 5 189 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
C3N8G6 3.09e-26 102 33 5 190 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MTW8 3.09e-26 102 33 5 190 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C3MJI5 3.09e-26 102 33 5 190 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
C4KJM8 3.09e-26 102 33 5 190 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3N0H8 3.09e-26 102 33 5 190 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain M.16.27)
C3NJQ5 4.35e-26 102 33 5 190 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
Q4JBL7 6.12e-25 99 31 4 187 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q97A64 1.94e-23 95 31 3 183 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
A3MWC5 6.12e-23 93 34 5 184 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Pyrobaculum calidifontis (strain DSM 21063 / JCM 11548 / VA1)
Q8ZZA9 2.13e-22 92 32 3 186 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
O87694 2.07e-17 82 32 3 173 1 cbiET Cobalamin biosynthesis bifunctional protein CbiET Priestia megaterium
Q8TI93 2.57e-16 76 31 4 179 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9HKE4 4.06e-15 73 25 3 183 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
A5UJR5 1.48e-13 68 27 5 188 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Q8PY64 1.97e-13 68 27 4 177 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
P21921 3.2e-12 67 33 4 184 1 cobL Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] Sinorhizobium sp.
O26249 2.06e-11 63 28 5 184 1 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q57836 1.92e-10 60 25 6 184 1 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q9HZU0 2.31e-10 62 29 5 196 3 cobL Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6UPM1 5.03e-09 56 25 6 188 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q9HPN4 7.45e-09 56 27 5 169 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
A4FWV6 1.49e-08 55 24 6 186 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A6VGG1 4.22e-08 53 23 6 183 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
P61820 8.79e-08 53 24 7 184 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A9AA91 1.2e-07 52 25 8 185 3 cbiT Probable cobalt-precorrin-6B C(15)-methyltransferase (decarboxylating) Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
P9WGA9 5.33e-07 52 28 4 183 1 cobL Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q32GZ5 4.82e-06 48 34 1 81 3 prmC Release factor glutamine methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
P9WGA8 5.08e-06 49 28 4 183 3 cobL Precorrin-6Y C(5,15)-methyltransferase [decarboxylating] Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0ACC2 2.08e-05 47 33 1 81 3 prmC Release factor glutamine methyltransferase Shigella flexneri
P0ACC1 2.08e-05 47 33 1 81 1 prmC Release factor glutamine methyltransferase Escherichia coli (strain K12)
P40816 5.62e-05 45 31 1 66 3 prmC Release factor glutamine methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5E6T2 7.88e-05 45 27 2 88 3 prmC Release factor glutamine methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B4RR25 0.000286 43 25 2 97 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria gonorrhoeae (strain NCCP11945)
Q5F5X7 0.000286 43 25 2 97 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9M3R8 0.000353 43 25 2 97 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria meningitidis serogroup C (strain 053442)
C6E4U6 0.000564 42 42 1 52 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geobacter sp. (strain M21)
Q9K1G3 0.00076 42 24 2 97 3 rsmG Ribosomal RNA small subunit methyltransferase G Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17085
Feature type CDS
Gene cbiT
Product decarboxylating cobalt-precorrin-6B (C(15))-methyltransferase
Location 21994 - 22563 (strand: -1)
Length 570 (nucleotides) / 189 (amino acids)

Contig

Accession ZDB_231
Length 52966 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3088
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF03602 Conserved hypothetical protein 95

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2242 Coenzyme transport and metabolism (H) H Precorrin-6B methylase 2

Kegg Ortholog Annotation(s)

Protein Sequence

MKDELFLRGQQIPMTKEPVRALALSRLDLQGAQRLIDVGAGTGSVSIEAALSHPALEIIAIEKKPEAIALIKENCLHFRCPQIRVIDAYAPVELAEKADAVFVGGTGGNLTEIIDWSLDHLHSDGTLVMTFILLDNLTQAIAHLKQCAVSELDCCELQAGNMTALGHSYYFKPNNPTYLISCRKEARCG

Flanking regions ( +/- flanking 50bp)

GATTACAACATGAATGTGGTGTTAATTGATAAGCGGGGCAGCGTGGCCTGATGAAAGACGAACTGTTTTTACGCGGGCAGCAGATCCCGATGACCAAAGAGCCGGTGAGAGCGCTCGCCCTGTCACGGCTGGATTTACAGGGTGCACAGCGCCTGATTGATGTGGGTGCGGGCACCGGCAGTGTTTCAATTGAAGCGGCACTCAGCCACCCGGCGCTTGAGATTATTGCCATCGAGAAAAAACCGGAAGCCATTGCGCTGATCAAAGAGAACTGCCTCCATTTCCGCTGTCCGCAGATACGCGTGATTGACGCGTATGCGCCGGTGGAACTGGCCGAAAAAGCAGATGCCGTGTTTGTCGGCGGTACCGGAGGAAATCTCACGGAGATTATCGACTGGTCTCTCGATCATCTGCACAGCGACGGCACCCTGGTGATGACCTTTATCCTGCTGGATAACCTGACACAAGCCATTGCGCACCTGAAACAGTGTGCGGTGAGCGAACTGGACTGCTGTGAATTACAGGCCGGAAATATGACCGCGCTCGGACACAGTTATTATTTTAAACCGAATAATCCTACCTATCTTATTTCCTGCCGTAAGGAGGCGCGTTGTGGCTGAACAGTTTGACCGTCAGAAAGTCTGGTTTGTCGGAGCCGGTCCCGGGGATA