Homologs in group_3077

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18830 FBDBKF_18830 100.0 Morganella morganii S1 cobU bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase
NLDBIP_18405 NLDBIP_18405 100.0 Morganella morganii S4 cobU bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase
LHKJJB_09220 LHKJJB_09220 100.0 Morganella morganii S3 cobU bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase
HKOGLL_08770 HKOGLL_08770 100.0 Morganella morganii S5 cobU bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase
F4V73_RS13765 F4V73_RS13765 94.5 Morganella psychrotolerans cobU bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase

Distribution of the homologs in the orthogroup group_3077

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3077

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE76 6.21e-68 207 56 1 181 2 cobU Bifunctional adenosylcobalamin biosynthesis protein CobU Escherichia coli (strain K12)
P0AE77 6.21e-68 207 56 1 181 3 cobU Bifunctional adenosylcobalamin biosynthesis protein CobU Escherichia coli O157:H7
Q05599 1.09e-65 202 55 1 181 1 cobU Bifunctional adenosylcobalamin biosynthesis protein CobU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P29931 3.96e-30 111 32 1 180 1 cobP Bifunctional adenosylcobalamin biosynthesis protein CobP Sinorhizobium sp.
Q9I466 1.28e-25 99 34 2 179 3 cobP Bifunctional adenosylcobalamin biosynthesis protein CobP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_17025
Feature type CDS
Gene cobU
Product bifunctional adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase
Location 12533 - 13078 (strand: -1)
Length 546 (nucleotides) / 181 (amino acids)
In genomic island -

Contig

Accession ZDB_231
Length 52966 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3077
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02283 Cobinamide kinase / cobinamide phosphate guanyltransferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2087 Coenzyme transport and metabolism (H) H Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02231 adenosylcobinamide kinase / adenosylcobinamide-phosphate guanylyltransferase [EC:2.7.1.156 2.7.7.62] Porphyrin metabolism
Metabolic pathways
Biosynthesis of cofactors
Cobalamin biosynthesis, cobyrinate a,c-diamide => cobalamin

Protein Sequence

MILITGGARSGKSSFAEELVDNRCHSALYIATSVVTDDEMAARVARHKADRPQHWRTWEGFKNIAHAIRYERKPGEGVMLECITTLIANLLYDASGGADPDTLDYAQMEIGINSEIDHIIDACKESECPVYIVTNELGMSITPENRLARHFVDIAGRINQKLARQAEQVWLVVSGIGVQIK

Flanking regions ( +/- flanking 50bp)

AATATTGATGAAATCTGCCGTCTGATGCGTGTACACAAGGAGAAAAAAGCATGATTTTAATTACCGGCGGCGCCCGCAGCGGTAAAAGCAGTTTTGCTGAAGAACTGGTGGATAACCGCTGTCACAGTGCGCTCTATATCGCCACCTCAGTGGTGACGGATGATGAAATGGCCGCCCGCGTGGCACGCCATAAGGCCGATCGCCCGCAGCACTGGCGTACGTGGGAAGGTTTTAAAAACATTGCCCATGCTATCCGTTATGAACGCAAACCGGGCGAAGGGGTGATGCTGGAATGCATCACCACGCTGATTGCCAATCTGCTCTATGACGCCTCGGGCGGCGCGGATCCGGACACGCTCGATTACGCGCAGATGGAGATCGGTATCAACAGCGAAATCGACCATATTATTGATGCCTGCAAAGAGAGTGAGTGCCCGGTGTATATCGTCACCAACGAACTGGGGATGAGCATCACACCGGAAAACCGGCTGGCGCGTCATTTTGTCGATATCGCCGGACGTATTAATCAGAAACTCGCCCGTCAGGCCGAACAGGTCTGGCTGGTGGTCTCCGGGATCGGAGTTCAGATCAAATGAACCTGAAATACCTGTGGGCGACACTCCAGTTTATTACCCGCATTCCGGTG