Homologs in group_2419

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19530 FBDBKF_19530 100.0 Morganella morganii S1 ubiC chorismate lyase
NLDBIP_16685 NLDBIP_16685 100.0 Morganella morganii S4 ubiC chorismate lyase
LHKJJB_16785 LHKJJB_16785 100.0 Morganella morganii S3 ubiC chorismate lyase
HKOGLL_18830 HKOGLL_18830 100.0 Morganella morganii S5 ubiC chorismate lyase
F4V73_RS18595 F4V73_RS18595 81.3 Morganella psychrotolerans ubiC chorismate lyase
PMI_RS13570 PMI_RS13570 58.2 Proteus mirabilis HI4320 ubiC chorismate lyase

Distribution of the homologs in the orthogroup group_2419

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2419

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JNE7 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FH1 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRU9 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pestis (strain Pestoides F)
Q1CE94 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYL0 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJ20 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pestis
B2K1U3 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0T7 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNA0 5.72e-62 191 60 2 160 3 ubiC Chorismate pyruvate-lyase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6G5M1 6.29e-61 189 58 2 160 3 ubiC Probable chorismate pyruvate-lyase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6FZ67 6.49e-61 189 58 2 163 3 ubiC Probable chorismate pyruvate-lyase Bartonella quintana (strain Toulouse)
A8GKB8 5.58e-60 186 59 2 164 3 ubiC Chorismate pyruvate-lyase Serratia proteamaculans (strain 568)
A1UTE7 1.19e-59 186 56 2 164 3 ubiC Probable chorismate pyruvate-lyase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q7MZB5 5.58e-59 184 57 2 159 3 ubiC Chorismate pyruvate-lyase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EYR7 5.82e-59 184 57 3 167 3 ubiC Chorismate pyruvate-lyase Proteus mirabilis (strain HI4320)
A1JRU5 4.08e-58 181 57 2 164 3 ubiC Chorismate pyruvate-lyase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VKA5 2.34e-54 172 57 2 156 3 ubiC Chorismate pyruvate-lyase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MPN9 3.39e-52 167 56 1 155 3 ubiC Chorismate pyruvate-lyase Cronobacter sakazakii (strain ATCC BAA-894)
B5XXZ3 7.58e-52 166 56 1 155 3 ubiC Chorismate pyruvate-lyase Klebsiella pneumoniae (strain 342)
A6TGU8 1.27e-51 165 55 1 155 3 ubiC Chorismate pyruvate-lyase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A9IWF5 1.8e-51 165 54 3 160 3 ubiC Probable chorismate pyruvate-lyase Bartonella tribocorum (strain CIP 105476 / IBS 506)
C6DKC8 2.16e-51 165 55 2 156 3 ubiC Chorismate pyruvate-lyase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D9I9 5.84e-50 161 54 2 156 3 ubiC Chorismate pyruvate-lyase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C4K6Q1 5.99e-50 161 54 1 146 3 ubiC Chorismate pyruvate-lyase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B5R7T2 9.14e-50 160 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q8ZKI0 1.37e-49 160 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BJV6 1.37e-49 160 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella paratyphi A (strain AKU_12601)
Q5PL18 1.37e-49 160 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5QZ58 1.37e-49 160 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella enteritidis PT4 (strain P125109)
C0Q4D8 1.84e-49 159 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella paratyphi C (strain RKS4594)
A9N1L2 1.84e-49 159 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T1S8 1.84e-49 159 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella newport (strain SL254)
B4TDL6 1.84e-49 159 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella heidelberg (strain SL476)
B5FQQ7 1.84e-49 159 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella dublin (strain CT_02021853)
Q57GZ4 1.84e-49 159 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella choleraesuis (strain SC-B67)
B5F1Q2 1.84e-49 159 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella agona (strain SL483)
B4TQQ1 5.35e-49 158 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella schwarzengrund (strain CVM19633)
A9MH91 6.73e-49 158 54 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z1T7 6.88e-49 158 53 1 155 3 ubiC Chorismate pyruvate-lyase Salmonella typhi
A4W5F2 2.39e-48 157 52 1 155 3 ubiC Chorismate pyruvate-lyase Enterobacter sp. (strain 638)
Q3YUU5 9.34e-48 155 52 1 155 3 ubiC Chorismate pyruvate-lyase Shigella sonnei (strain Ss046)
B7NS03 1.2e-47 155 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7NFY3 1.49e-47 155 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q83IP6 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Shigella flexneri
Q0SXQ6 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Shigella flexneri serotype 5b (strain 8401)
Q31TU7 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Shigella boydii serotype 4 (strain Sb227)
B2TX77 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LPK4 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain SMS-3-5 / SECEC)
B6I5Q4 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain SE11)
B1IUL3 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A7D9 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O9:H4 (strain HS)
A7ZUR1 2.14e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q327U6 2.6e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Shigella dysenteriae serotype 1 (strain Sd197)
B7M7V2 2.6e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O8 (strain IAI1)
B7LAY7 2.6e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain 55989 / EAEC)
Q1R3P7 3.81e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain UTI89 / UPEC)
Q8FB35 3.81e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TA23 3.81e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AIL6 3.81e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O1:K1 / APEC
B7N2P6 3.81e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O81 (strain ED1a)
B7MJ29 3.81e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPK0 3.81e-47 154 52 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8AN89 6.16e-47 153 51 1 155 3 ubiC Chorismate pyruvate-lyase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P26602 9.01e-46 150 51 1 155 1 ubiC Chorismate pyruvate-lyase Escherichia coli (strain K12)
B1XC38 9.01e-46 150 51 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain K12 / DH10B)
C5A132 9.01e-46 150 51 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli (strain K12 / MC4100 / BW2952)
B5Z180 1.1e-45 150 51 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XEC3 1.1e-45 150 51 1 155 3 ubiC Chorismate pyruvate-lyase Escherichia coli O157:H7
Q2NR06 2.22e-39 134 47 3 157 3 ubiC Chorismate pyruvate-lyase Sodalis glossinidius (strain morsitans)
Q6LVS4 9.64e-30 110 41 2 143 3 ubiC Probable chorismate pyruvate-lyase Photobacterium profundum (strain SS9)
Q87KM8 7.06e-27 102 39 3 143 3 ubiC Probable chorismate pyruvate-lyase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9KVP6 1.97e-25 99 34 2 155 3 ubiC Probable chorismate pyruvate-lyase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q5E206 1.88e-24 96 37 2 143 3 ubiC Probable chorismate pyruvate-lyase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8DD50 7.03e-24 95 38 2 143 3 ubiC Probable chorismate pyruvate-lyase Vibrio vulnificus (strain CMCP6)
Q7MQ88 1.66e-23 94 38 2 143 3 ubiC Probable chorismate pyruvate-lyase Vibrio vulnificus (strain YJ016)
A3QJG1 5.36e-19 82 30 3 163 3 ubiC Probable chorismate pyruvate-lyase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q48AM0 1.3e-17 79 31 4 172 3 ubiC Probable chorismate pyruvate-lyase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q12T34 4.21e-17 77 30 5 179 3 ubiC Probable chorismate pyruvate-lyase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q82TP3 7.2e-17 76 30 2 173 3 ubiC Probable chorismate pyruvate-lyase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1SBR9 8.13e-17 76 32 6 176 3 ubiC Probable chorismate pyruvate-lyase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A0KEP8 1.45e-15 73 33 3 151 3 ubiC Probable chorismate pyruvate-lyase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1U6P4 2e-15 73 32 3 167 3 ubiC Probable chorismate pyruvate-lyase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0AGZ8 2.26e-15 72 29 2 172 3 ubiC Probable chorismate pyruvate-lyase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q08A04 2.26e-14 70 30 9 205 3 ubiC Probable chorismate pyruvate-lyase Shewanella frigidimarina (strain NCIMB 400)
Q0VTA8 2.54e-14 70 31 4 149 3 ubiC Probable chorismate pyruvate-lyase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q15ZU0 2.79e-14 70 28 8 178 3 ubiC Probable chorismate pyruvate-lyase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3SLJ3 2.89e-14 70 29 3 168 3 ubiC Probable chorismate pyruvate-lyase Thiobacillus denitrificans (strain ATCC 25259)
Q8EKG2 5.73e-14 69 28 4 173 3 ubiC Probable chorismate pyruvate-lyase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0A5V8 5.96e-14 69 32 4 158 3 ubiC Probable chorismate pyruvate-lyase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1T086 1.5e-13 68 29 3 161 3 ubiC Probable chorismate pyruvate-lyase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q02E05 2.72e-13 67 31 5 161 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9HTK1 4.36e-13 66 30 5 160 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5P5L9 6.09e-13 66 31 4 157 3 ubiC Probable chorismate pyruvate-lyase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A4STB6 6.69e-13 66 32 3 152 3 ubiC Probable chorismate pyruvate-lyase Aeromonas salmonicida (strain A449)
A0KRF0 7.68e-13 66 27 4 173 3 ubiC Probable chorismate pyruvate-lyase Shewanella sp. (strain ANA-3)
Q0HP10 9.45e-13 66 27 4 173 3 ubiC Probable chorismate pyruvate-lyase Shewanella sp. (strain MR-4)
A1RQ05 9.9e-13 65 27 5 173 3 ubiC Probable chorismate pyruvate-lyase Shewanella sp. (strain W3-18-1)
Q0I0H9 1.13e-12 65 27 4 173 3 ubiC Probable chorismate pyruvate-lyase Shewanella sp. (strain MR-7)
A3M775 2.1e-12 64 31 6 143 3 ubiC Probable chorismate pyruvate-lyase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q31DN1 2.48e-12 65 30 4 170 3 ubiC Probable chorismate pyruvate-lyase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9CMB5 2.52e-12 64 30 5 147 3 ubiC Probable chorismate pyruvate-lyase Pasteurella multocida (strain Pm70)
A1WVN0 3.16e-12 64 35 5 151 3 ubiC Probable chorismate pyruvate-lyase Halorhodospira halophila (strain DSM 244 / SL1)
Q609A0 3.37e-12 63 29 1 157 3 ubiC Probable chorismate pyruvate-lyase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q2Y5S2 9.38e-12 63 30 4 168 3 ubiC Probable chorismate pyruvate-lyase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3K4G4 1.92e-11 62 28 5 165 3 ubiC2 Probable chorismate pyruvate-lyase 2 Pseudomonas fluorescens (strain Pf0-1)
Q5QUP2 3.43e-11 62 28 4 177 3 ubiC Probable chorismate pyruvate-lyase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q88C66 5.29e-11 61 30 4 159 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1GXB4 7.85e-11 60 27 4 160 3 ubiC Probable chorismate pyruvate-lyase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q6F9N7 1.28e-10 60 29 5 144 3 ubiC Probable chorismate pyruvate-lyase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q4K3M0 3.83e-10 58 28 5 166 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q4ZLB5 4.78e-10 58 28 5 166 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas syringae pv. syringae (strain B728a)
Q1QE02 7.98e-10 57 28 4 147 3 ubiC Probable chorismate pyruvate-lyase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q9FD32 1.96e-09 57 31 4 148 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas putida
Q48BQ6 2.01e-09 57 28 4 152 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q87U40 3.82e-09 56 28 5 149 3 ubiC Probable chorismate pyruvate-lyase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1I2R4 5.79e-09 55 31 5 152 3 ubiC2 Probable chorismate pyruvate-lyase 2 Pseudomonas entomophila (strain L48)
Q4FUZ9 1.47e-08 54 29 2 108 3 ubiC Probable chorismate pyruvate-lyase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A1K2P0 2.05e-08 54 29 5 164 3 ubiC Probable chorismate pyruvate-lyase Azoarcus sp. (strain BH72)
Q47AZ9 3.38e-08 53 30 3 153 3 ubiC Probable chorismate pyruvate-lyase Dechloromonas aromatica (strain RCB)
Q83F94 7.95e-07 50 27 5 161 3 ubiC Probable chorismate pyruvate-lyase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q1BUR8 9.67e-07 50 26 5 156 3 ubiC Probable chorismate pyruvate-lyase Burkholderia orbicola (strain AU 1054)
A0K9B9 9.67e-07 50 26 5 156 3 ubiC Probable chorismate pyruvate-lyase Burkholderia cenocepacia (strain HI2424)
Q2L1H6 1.71e-06 49 26 4 151 3 ubiC Probable chorismate pyruvate-lyase Bordetella avium (strain 197N)
Q63W06 1.71e-06 49 27 4 133 3 ubiC Probable chorismate pyruvate-lyase Burkholderia pseudomallei (strain K96243)
Q62ID2 1.71e-06 49 27 4 133 3 ubiC Probable chorismate pyruvate-lyase Burkholderia mallei (strain ATCC 23344)
Q3JUM4 1.71e-06 49 27 4 133 3 ubiC2 Probable chorismate pyruvate-lyase 2 Burkholderia pseudomallei (strain 1710b)
Q2SZY9 3.32e-06 48 27 4 133 3 ubiC Probable chorismate pyruvate-lyase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q142T1 1.06e-05 47 26 5 160 3 ubiC Probable chorismate pyruvate-lyase Paraburkholderia xenovorans (strain LB400)
Q39E37 1.3e-05 47 26 6 161 3 ubiC Probable chorismate pyruvate-lyase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1QSG3 2.14e-05 46 28 3 150 3 ubiC Probable chorismate pyruvate-lyase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0BD35 3.81e-05 45 25 4 132 3 ubiC Probable chorismate pyruvate-lyase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q3KIF2 0.000195 43 29 1 117 3 ubiC1 Probable chorismate pyruvate-lyase 1 Pseudomonas fluorescens (strain Pf0-1)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_16475
Feature type CDS
Gene ubiC
Product chorismate lyase
Location 13043 - 13543 (strand: 1)
Length 501 (nucleotides) / 166 (amino acids)

Contig

Accession ZDB_229
Length 57314 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2419
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04345 Chorismate lyase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3161 Coenzyme transport and metabolism (H) H 4-hydroxybenzoate synthetase (chorismate-pyruvate lyase)

Kegg Ortholog Annotation(s)

Protein Sequence

MTQTVITPPIRWFDNAEMIPAGVLDWLSELGSMTRRFEQHCNEVTVKPYCEKYISREALTEEEQMHLPGSARYWLREVVLYGDGVPWLTGRTVVPEETLTGEEQQLLKMGNVPLGRYLFTSGCLTRDYIRFGLSETHWARCSRLCLAGKPLLLTEVFLPASPAYPA

Flanking regions ( +/- flanking 50bp)

GTTAAAGTGTATCAGAACGCATATTATGCCCCTGATAACCGGATACATTCATGACACAAACAGTGATAACACCCCCCATCCGCTGGTTTGATAATGCGGAAATGATCCCCGCCGGGGTGCTGGACTGGTTATCAGAATTAGGGTCAATGACGCGGCGCTTTGAACAGCACTGCAATGAAGTGACGGTAAAACCGTATTGTGAAAAATATATCTCCCGTGAAGCGCTGACTGAAGAAGAGCAGATGCATCTGCCCGGCAGTGCACGCTACTGGTTACGGGAGGTGGTGTTATATGGTGACGGGGTTCCCTGGCTGACCGGCCGGACAGTGGTACCGGAGGAGACGCTGACAGGGGAAGAGCAGCAGTTACTGAAAATGGGAAATGTGCCGCTCGGGCGCTATCTCTTTACCAGCGGTTGTCTGACGCGGGATTATATCCGCTTCGGGCTGTCAGAAACCCACTGGGCCCGCTGTTCGCGGTTGTGCCTGGCCGGTAAACCGCTGCTGCTGACTGAAGTTTTTCTGCCGGCCTCTCCGGCATACCCCGCATAAGTGAATATCTCGGAGAAGAATAACGTGGAACGAAGCATGGTACGCAGCAA