Homologs in group_3465

Help

4 homologs were identified in 4 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15730 FBDBKF_15730 100.0 Morganella morganii S1 merR mercury resistance transcriptional regulator MerR
NLDBIP_16280 NLDBIP_16280 100.0 Morganella morganii S4 merR mercury resistance transcriptional regulator MerR
LHKJJB_16520 LHKJJB_16520 100.0 Morganella morganii S3 merR mercury resistance transcriptional regulator MerR
HKOGLL_16290 HKOGLL_16290 100.0 Morganella morganii S5 merR mercury resistance transcriptional regulator MerR

Distribution of the homologs in the orthogroup group_3465

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3465

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P13111 9.63e-94 270 89 0 144 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
P69413 6.52e-91 263 94 0 134 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 6.52e-91 263 94 0 134 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 6.52e-91 263 94 0 134 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
P0A2Q9 4.08e-89 258 91 0 135 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 4.08e-89 258 91 0 135 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
P22853 1.18e-25 97 39 1 128 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
P22874 1.04e-19 82 33 1 130 4 merR Mercuric resistance operon regulatory protein Staphylococcus aureus
P0ACS5 1.87e-18 79 34 3 128 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 1.87e-18 79 34 3 128 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
P22896 6.11e-18 77 36 2 119 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
P45277 8.63e-18 77 36 1 108 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9X5X4 2.92e-15 71 31 2 124 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
P58379 7.01e-15 70 32 2 124 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
Q55963 7.08e-15 69 32 1 118 4 slr0701 Uncharacterized HTH-type transcriptional regulator slr0701 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P44617 3.66e-14 67 28 2 129 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9X5V4 3.24e-13 65 32 4 127 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P0C6D2 1.93e-12 63 26 2 129 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2W6 1.93e-12 63 26 2 129 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P58378 6.73e-12 62 29 3 130 3 hmrR1 Heavy metal-dependent transcription regulator 1 Rhizobium meliloti (strain 1021)
Q9HV30 8.73e-12 61 28 2 127 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8ZCA8 3.21e-11 60 29 2 129 3 cueR HTH-type transcriptional regulator CueR Yersinia pestis
Q8FK74 5.08e-11 59 27 2 129 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XD09 1.26e-10 58 27 2 129 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
P0A9G5 1.64e-10 58 27 2 129 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 1.64e-10 58 27 2 129 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q93CH6 3.89e-10 57 26 2 129 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z8S3 7.47e-10 56 25 2 129 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
Q51506 3.14e-08 52 31 4 125 3 soxR Redox-sensitive transcriptional activator SoxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O06474 3.24e-08 52 35 1 71 2 yfmP HTH-type transcriptional regulator YfmP Bacillus subtilis (strain 168)
P37510 8.01e-08 51 34 1 79 4 yyaN Uncharacterized HTH-type transcriptional regulator YyaN Bacillus subtilis (strain 168)
P0A4T9 4.91e-07 50 38 0 68 1 tipA HTH-type transcriptional activator TipA Streptomyces lividans
P0A4T8 4.91e-07 50 38 0 68 3 tipA HTH-type transcriptional activator TipA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P44558 8.59e-07 48 33 2 95 1 HI_0186 Uncharacterized HTH-type transcriptional regulator HI_0186 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O06008 2.94e-06 47 26 4 142 1 adhR HTH-type transcriptional regulator AdhR Bacillus subtilis (strain 168)
P0A2Q6 1.35e-05 45 35 0 79 4 merD HTH-type transcriptional regulator MerD Salmonella typhi
P0A2Q7 1.35e-05 45 35 0 79 4 merD HTH-type transcriptional regulator MerD Enterobacter agglomerans
P50329 1.72e-05 46 37 0 61 4 nolA Nodulation protein NolA (Fragment) Bradyrhizobium elkanii
Q52110 1.83e-05 44 35 0 79 4 merD HTH-type transcriptional regulator MerD Acinetobacter calcoaceticus
P0ACS4 3.16e-05 44 28 4 125 3 soxR Redox-sensitive transcriptional activator SoxR Shigella flexneri
P0ACS2 3.16e-05 44 28 4 125 1 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli (strain K12)
P0ACS3 3.16e-05 44 28 4 125 3 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli O157:H7
P08654 4.83e-05 43 29 0 105 4 merD HTH-type transcriptional regulator MerD Serratia marcescens
P50330 6.67e-05 44 36 0 61 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)
P0A2R0 7.54e-05 43 28 4 125 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2R1 7.54e-05 43 28 4 125 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhi
P22537 0.00034 42 36 0 61 2 nolA Nodulation protein NolA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_16085
Feature type CDS
Gene merR
Product mercury resistance transcriptional regulator MerR
Location 77677 - 78111 (strand: 1)
Length 435 (nucleotides) / 144 (amino acids)

Contig

Accession ZDB_227
Length 79950 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3465
Orthogroup size 5
N. genomes 5

Actions

Genomic region

Domains

PF00376 MerR family regulatory protein
PF09278 MerR, DNA binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08365 MerR family transcriptional regulator, mercuric resistance operon regulatory protein - -

AMR gene Annotation(s)

Gene Description Scope Type Class Subclass HMM
merR mercury resistance transcriptional regulator MerR plus STRESS MERCURY MERCURY NF010315 

Protein Sequence

MENNLENLTIGVFARTAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGETDVTRLRFVKSAQRLGFSLDEIAELLRLEDGTHCEEASSLAEHKLKDVRERMADLARMEAVLSDLVCACHARKGNVSCPLIASLQGKKEPRSADAV

Flanking regions ( +/- flanking 50bp)

AATTGGATAGCTTAAGCTTACTTCCGTAGTTATATACGGAGTCAAGCGATATGGAAAACAATTTGGAGAACCTGACCATTGGCGTTTTCGCCAGGACGGCCGGGGTCAATGTGGAGACCATCCGGTTCTATCAGCGCAAGGGCTTGCTCCCGGAACCGGACAAGCCTTACGGCAGCATTCGCCGCTATGGCGAGACGGATGTAACGCGGCTGCGCTTCGTGAAATCAGCCCAGCGGTTGGGCTTCAGCCTGGATGAGATCGCCGAGCTGCTGCGGCTGGAGGATGGCACCCATTGCGAGGAAGCCAGCAGCCTGGCCGAGCACAAGCTCAAGGACGTGCGCGAGAGGATGGCTGACCTGGCGCGCATGGAGGCCGTGCTGTCTGATTTGGTGTGCGCCTGCCATGCGCGGAAGGGGAACGTTTCCTGCCCGCTGATTGCGTCACTGCAAGGGAAGAAAGAACCGCGCAGTGCGGACGCGGTGTAGCCCGAGGGAACTACGCCTTAGCGTGCTTTATTTTCCGTTTTCTGAGGCGA