Homologs in group_1938

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14550 FBDBKF_14550 100.0 Morganella morganii S1 rluE 23S rRNA pseudouridine(2457) synthase RluE
NLDBIP_15885 NLDBIP_15885 100.0 Morganella morganii S4 rluE 23S rRNA pseudouridine(2457) synthase RluE
LHKJJB_15955 LHKJJB_15955 100.0 Morganella morganii S3 rluE 23S rRNA pseudouridine(2457) synthase RluE
HKOGLL_15075 HKOGLL_15075 100.0 Morganella morganii S5 rluE 23S rRNA pseudouridine(2457) synthase RluE
F4V73_RS07345 F4V73_RS07345 75.1 Morganella psychrotolerans rluE 23S rRNA pseudouridine(2457) synthase RluE
PMI_RS04375 PMI_RS04375 63.2 Proteus mirabilis HI4320 rluE 23S rRNA pseudouridine(2457) synthase RluE

Distribution of the homologs in the orthogroup group_1938

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1938

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q83LF6 2.1e-102 298 72 0 191 3 rluE Ribosomal large subunit pseudouridine synthase E Shigella flexneri
P75966 2.5e-102 298 73 0 191 1 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli (strain K12)
Q8X724 5.12e-101 295 72 0 191 3 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli O157:H7
Q8FIB6 1.95e-100 293 71 0 191 3 rluE Ribosomal large subunit pseudouridine synthase E Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8ZFQ3 7.12e-99 289 70 0 189 3 rluE Ribosomal large subunit pseudouridine synthase E Yersinia pestis
Q8ZPZ1 1.97e-97 286 69 0 189 3 rluE Ribosomal large subunit pseudouridine synthase E Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z7G6 1.14e-95 281 68 0 189 3 rluE Ribosomal large subunit pseudouridine synthase E Salmonella typhi
Q9F855 4.63e-85 255 66 2 192 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9HX48 3.19e-81 243 69 1 176 3 rluE Ribosomal large subunit pseudouridine synthase E Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8DAS3 7.78e-80 241 53 2 218 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio vulnificus (strain CMCP6)
Q87QY8 6.12e-79 239 61 1 178 3 rluE Ribosomal large subunit pseudouridine synthase E Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CKK7 3.5e-78 238 50 2 229 3 rluE Ribosomal large subunit pseudouridine synthase E Pasteurella multocida (strain Pm70)
P44827 4.4e-75 230 62 1 174 3 rluE Ribosomal large subunit pseudouridine synthase E Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8PQN3 5.13e-67 207 58 1 175 3 rluE Ribosomal large subunit pseudouridine synthase E Xanthomonas axonopodis pv. citri (strain 306)
Q8PDR2 2.26e-60 191 54 1 175 3 rluE Ribosomal large subunit pseudouridine synthase E Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
P72581 8.58e-56 181 49 4 209 3 slr0612 Uncharacterized RNA pseudouridine synthase slr0612 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O67444 9.28e-29 111 37 3 181 3 aq_1464 Uncharacterized RNA pseudouridine synthase aq_1464 Aquifex aeolicus (strain VF5)
P35159 1.77e-26 105 37 3 177 1 rluB Ribosomal large subunit pseudouridine synthase B Bacillus subtilis (strain 168)
P57369 5.52e-24 99 32 3 180 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q55578 1.21e-23 98 34 5 221 3 slr0361 Uncharacterized RNA pseudouridine synthase slr0361 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q1RJR2 9.87e-23 95 34 4 185 3 RBE_0321 Uncharacterized RNA pseudouridine synthase RBE_0321 Rickettsia bellii (strain RML369-C)
P65843 8.88e-22 93 35 3 176 3 BQ2027_MB1738 Uncharacterized RNA pseudouridine synthase Mb1738 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ1 8.88e-22 93 35 3 176 1 Rv1711 Uncharacterized RNA pseudouridine synthase Rv1711 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WHQ0 8.88e-22 93 35 3 176 3 MT1751.1 Uncharacterized RNA pseudouridine synthase MT1751.1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q8Z7D5 8.27e-20 88 33 4 196 3 rluB Ribosomal large subunit pseudouridine synthase B Salmonella typhi
Q8ZP51 1.06e-19 88 33 4 196 3 rluB Ribosomal large subunit pseudouridine synthase B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42395 1.47e-19 87 30 4 183 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q9KRK5 2.35e-19 86 33 5 193 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
O05668 5.76e-19 85 32 3 178 3 ML1370 Uncharacterized RNA pseudouridine synthase ML1370 Mycobacterium leprae (strain TN)
Q9I5J6 7.53e-19 85 33 5 183 3 rsuA Ribosomal small subunit pseudouridine synthase A Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4UL59 1.15e-18 84 30 5 180 3 RF_0863 Uncharacterized RNA pseudouridine synthase RF_0863 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P45104 1.21e-18 86 33 4 181 1 rluB Ribosomal large subunit pseudouridine synthase B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CMY9 1.61e-18 85 32 4 186 3 rluB Ribosomal large subunit pseudouridine synthase B Pasteurella multocida (strain Pm70)
Q92HG4 2.48e-18 83 28 4 180 3 RC0807 Uncharacterized RNA pseudouridine synthase RC0807 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P59815 2.69e-18 84 32 4 191 3 rluB Ribosomal large subunit pseudouridine synthase B Shigella flexneri
Q8X4Q8 2.92e-18 84 32 4 191 3 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli O157:H7
P37765 3.05e-18 84 32 4 191 1 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli (strain K12)
Q8FHV4 3.21e-18 84 32 4 191 3 rluB Ribosomal large subunit pseudouridine synthase B Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8ZEG0 3.23e-18 84 32 4 186 3 rluB Ribosomal large subunit pseudouridine synthase B Yersinia pestis
O32068 1.24e-17 82 30 5 178 3 ytzG Uncharacterized RNA pseudouridine synthase YtzG Bacillus subtilis (strain 168)
Q87QD4 3.24e-17 80 33 6 193 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9ZD06 4.75e-17 80 29 4 176 3 RP544 Uncharacterized RNA pseudouridine synthase RP544 Rickettsia prowazekii (strain Madrid E)
Q68WJ1 7.11e-17 80 30 5 180 3 RT0532 Uncharacterized RNA pseudouridine synthase RT0532 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9HZ55 1.37e-16 80 30 3 182 3 rluB Ribosomal large subunit pseudouridine synthase B Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P65840 1.4e-16 79 33 8 184 3 rsuA Ribosomal small subunit pseudouridine synthase A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65841 1.4e-16 79 33 8 184 3 rsuA Ribosomal small subunit pseudouridine synthase A Salmonella typhi
Q8ZGM2 1.47e-16 79 33 8 183 3 rsuA Ribosomal small subunit pseudouridine synthase A Yersinia pestis
P0AA46 1.54e-16 79 32 7 184 3 rsuA Ribosomal small subunit pseudouridine synthase A Shigella flexneri
P0AA43 1.54e-16 79 32 7 184 1 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli (strain K12)
P0AA44 1.54e-16 79 32 7 184 3 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA45 1.54e-16 79 32 7 184 3 rsuA Ribosomal small subunit pseudouridine synthase A Escherichia coli O157:H7
O66829 1.69e-16 79 30 3 156 3 aq_554 Uncharacterized RNA pseudouridine synthase aq_554 Aquifex aeolicus (strain VF5)
Q89AL1 2.42e-16 78 31 5 189 3 rluB Ribosomal large subunit pseudouridine synthase B Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P45124 1.84e-15 75 33 3 152 1 rsuA Ribosomal small subunit pseudouridine synthase A Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8D8X2 1.85e-15 75 28 6 214 3 rsuA Ribosomal small subunit pseudouridine synthase A Vibrio vulnificus (strain CMCP6)
Q9KSS7 8.26e-15 75 30 4 191 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P32684 1.36e-14 74 27 4 202 1 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli (strain K12)
Q8D8C0 1.99e-14 74 30 4 185 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio vulnificus (strain CMCP6)
Q8FB47 4.62e-14 72 28 5 202 3 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8X4L9 6.16e-14 72 28 5 202 3 rluF Dual-specificity RNA pseudouridine synthase RluF Escherichia coli O157:H7
Q83IR6 6.47e-14 72 29 5 187 3 rluF Dual-specificity RNA pseudouridine synthase RluF Shigella flexneri
Q87NB7 1.31e-13 72 30 4 186 3 rluB Ribosomal large subunit pseudouridine synthase B Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CPN4 1.93e-13 70 30 3 155 3 rsuA Ribosomal small subunit pseudouridine synthase A Pasteurella multocida (strain Pm70)
Q8Z1V3 3.73e-13 70 28 5 187 3 rluF Dual-specificity RNA pseudouridine synthase RluF Salmonella typhi
Q8ZKL1 4.32e-13 70 28 5 187 3 rluF Dual-specificity RNA pseudouridine synthase RluF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O51155 6.99e-13 69 28 2 144 3 BB_0129 Uncharacterized RNA pseudouridine synthase BB_0129 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8L960 5.61e-12 67 26 5 217 1 SVR1 Putative ribosomal large subunit pseudouridine synthase SVR1, chloroplastic Arabidopsis thaliana
Q87BI2 3e-10 62 31 4 176 3 rluB Ribosomal large subunit pseudouridine synthase B Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PAP2 3.49e-10 62 31 4 176 3 rluB Ribosomal large subunit pseudouridine synthase B Xylella fastidiosa (strain 9a5c)
Q8P8M6 2.14e-09 60 31 6 174 3 rluB Ribosomal large subunit pseudouridine synthase B Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PK58 2.92e-09 60 30 5 175 3 rluB Ribosomal large subunit pseudouridine synthase B Xanthomonas axonopodis pv. citri (strain 306)
P55986 2.47e-08 56 26 4 189 3 HP_1459 Uncharacterized RNA pseudouridine synthase HP_1459 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZJG0 3.07e-08 56 26 4 189 3 jhp_1352 Uncharacterized RNA pseudouridine synthase jhp_1352 Helicobacter pylori (strain J99 / ATCC 700824)
Q9KP71 5.47e-05 46 29 8 185 3 rluA Dual-specificity RNA pseudouridine synthase RluA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_15355
Feature type CDS
Gene rluE
Product 23S rRNA pseudouridine(2457) synthase RluE
Location 35100 - 35789 (strand: 1)
Length 690 (nucleotides) / 229 (amino acids)

Contig

Accession ZDB_226
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1938
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00849 RNA pseudouridylate synthase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1187 Translation, ribosomal structure and biogenesis (J) J Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06181 23S rRNA pseudouridine2457 synthase [EC:5.4.99.20] - -

Protein Sequence

MTGKTTNSRISRKPQSRPAGAHPRQKAARKPRPRGPRKIILFNKPFDVLPQFTDEAGRSTLKDYIPVTDVYAAGRLDRDSEGLLILTNDGALQAALTQPENKAPKVYYAQVEGVPDENALNQLRNGITLNDGPTRPAGAELVDEPEWLWPRNPPIRERKSVPVSWLKLTLREGRNRQVRRMTAHTGHPTLRLIRVRIGDFALDTLAPGEWREVNDIQTSCDSGLPGQRR

Flanking regions ( +/- flanking 50bp)

AACTGTTTTAAGCTATAATGTAAGTCTCATTTTTATGTAAAAAAAAGATAATGACCGGTAAAACCACGAACTCCCGCATCTCCCGAAAGCCGCAATCCCGTCCGGCAGGCGCCCATCCGCGTCAGAAAGCTGCCCGCAAACCCCGGCCGCGCGGTCCGCGCAAAATTATTCTGTTCAATAAACCGTTTGATGTACTGCCTCAGTTTACCGATGAAGCCGGACGCAGCACGCTGAAAGATTACATTCCGGTTACAGATGTGTACGCCGCCGGGCGGTTGGATCGCGACAGCGAAGGGTTACTTATCCTGACCAACGACGGCGCATTGCAGGCAGCTCTGACACAGCCGGAGAACAAAGCCCCGAAAGTGTATTATGCTCAGGTGGAAGGTGTGCCGGACGAAAACGCGCTGAATCAGTTGCGTAACGGTATCACTCTGAATGATGGCCCGACCCGCCCTGCCGGTGCTGAGCTGGTGGATGAGCCGGAGTGGCTGTGGCCGCGTAATCCGCCTATCCGCGAGCGGAAATCGGTGCCGGTCAGTTGGCTGAAACTGACACTGCGGGAAGGCCGTAACCGCCAGGTACGCCGGATGACCGCCCATACCGGCCACCCGACCCTGCGTCTGATCCGCGTGCGGATTGGTGATTTTGCCCTTGATACCCTTGCCCCCGGCGAATGGAGAGAAGTGAATGATATTCAGACCTCATGTGACAGTGGCCTGCCTGGTCAGCGCCGGTGAAAAATTTCTGGTGGTGGAAGAAACCGTTAACGGCAACGCCACCTGGAATC