Homologs in group_1623

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10700 FBDBKF_10700 100.0 Morganella morganii S1 nfuA NfuA family Fe-S biogenesis protein
NLDBIP_14865 NLDBIP_14865 100.0 Morganella morganii S4 nfuA NfuA family Fe-S biogenesis protein
LHKJJB_14480 LHKJJB_14480 100.0 Morganella morganii S3 nfuA NfuA family Fe-S biogenesis protein
HKOGLL_13100 HKOGLL_13100 100.0 Morganella morganii S5 nfuA NfuA family Fe-S biogenesis protein
F4V73_RS14415 F4V73_RS14415 94.8 Morganella psychrotolerans nfuA Fe-S biogenesis protein NfuA
PMI_RS14465 PMI_RS14465 88.0 Proteus mirabilis HI4320 nfuA Fe-S biogenesis protein NfuA

Distribution of the homologs in the orthogroup group_1623

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1623

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N9W2 3.44e-128 361 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A9MMB3 7.26e-128 360 91 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZLI7 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TY71 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella schwarzengrund (strain CVM19633)
C0Q0I7 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi C (strain RKS4594)
A9MTT1 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SVL5 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella newport (strain SL254)
B4TKT8 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella heidelberg (strain SL476)
B5R7K3 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R371 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella enteritidis PT4 (strain P125109)
B5FKD2 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella dublin (strain CT_02021853)
Q57IW3 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella choleraesuis (strain SC-B67)
B5F8M8 2.59e-127 358 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella agona (strain SL483)
B4EZM8 3.86e-127 358 88 0 192 3 nfuA Fe/S biogenesis protein NfuA Proteus mirabilis (strain HI4320)
A8AQW7 9.36e-127 357 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z223 1.03e-126 357 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella typhi
B5BHG9 1.39e-126 357 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi A (strain AKU_12601)
Q5PLY6 1.39e-126 357 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C5BGT5 2.25e-126 356 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Edwardsiella ictaluri (strain 93-146)
A7ME80 3.53e-126 356 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Cronobacter sakazakii (strain ATCC BAA-894)
Q3YWL1 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella sonnei (strain Ss046)
P63023 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella flexneri
Q0SZQ1 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella flexneri serotype 5b (strain 8401)
Q32AM7 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella dysenteriae serotype 1 (strain Sd197)
Q31VL8 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella boydii serotype 4 (strain Sb227)
B2U3M4 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LSB7 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5M0 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain UTI89 / UPEC)
B1LHL4 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain SMS-3-5 / SECEC)
B6I2X8 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain SE11)
B7NE19 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P63020 4.12e-126 355 89 1 192 1 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12)
B1IP51 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P63021 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TC53 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGT8 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O1:K1 / APEC
A8A5M2 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O9:H4 (strain HS)
B1X760 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12 / DH10B)
C4ZVW3 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1X0 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O8 (strain IAI1)
B7N147 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O81 (strain ED1a)
B5YTW5 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P63022 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O157:H7
B7L4U4 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain 55989 / EAEC)
B7MDP0 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKB9 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSU3 4.12e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TF37 4.91e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTS2 4.91e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae (strain 342)
B7NMH9 1.87e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A4WFK2 3.24e-124 351 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Enterobacter sp. (strain 638)
B1JHZ3 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664J6 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGR7 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis (strain Pestoides F)
Q1CCL5 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4D2 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJI0 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis
B2K5V9 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2L8 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNW0 1.92e-122 346 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JSF6 3.43e-121 343 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8GKT7 6e-121 342 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Serratia proteamaculans (strain 568)
C6DH68 2.82e-120 341 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q2NQH5 6.42e-120 340 84 1 192 3 nfuA Fe/S biogenesis protein NfuA Sodalis glossinidius (strain morsitans)
Q6CZL7 4.1e-119 338 84 1 192 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2VJW0 7.49e-119 337 83 1 192 3 nfuA Fe/S biogenesis protein NfuA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9CKP9 6.91e-115 327 77 0 191 3 nfuA Fe/S biogenesis protein NfuA Pasteurella multocida (strain Pm70)
Q65QC1 3.28e-114 325 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B5FCD0 7.8e-113 322 79 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio fischeri (strain MJ11)
Q5E1Z0 7.8e-113 322 79 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio fischeri (strain ATCC 700601 / ES114)
A6VL27 3.7e-111 318 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C3LSE7 3.79e-111 318 77 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain M66-2)
Q9KNL2 3.79e-111 318 77 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P31774 5.13e-111 318 73 0 191 1 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGU4 6.18e-111 317 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain PittGG)
A5UA56 6.18e-111 317 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain PittEE)
Q4QNB2 6.18e-111 317 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain 86-028NP)
B6ENV8 8.06e-111 317 78 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio salmonicida (strain LFI1238)
C4K405 1.42e-110 316 78 1 192 3 nfuA Fe/S biogenesis protein NfuA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A5F4R9 5.88e-110 315 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MPY4 8.8e-110 314 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio vulnificus (strain YJ016)
Q8DDU2 8.8e-110 314 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio vulnificus (strain CMCP6)
Q6LVQ9 1.76e-109 313 76 0 192 3 nfuA Fe/S biogenesis protein NfuA Photobacterium profundum (strain SS9)
B0BS54 4.75e-109 313 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZZ1 4.75e-109 313 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYM1 4.75e-109 313 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q87TC4 1.39e-108 311 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B0URV5 2e-108 311 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Histophilus somni (strain 2336)
Q0I5I6 2e-108 311 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Histophilus somni (strain 129Pt)
A7MST1 2.09e-108 311 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio campbellii (strain ATCC BAA-1116)
B4S1U9 2.83e-108 310 75 0 192 3 nfuA Fe/S biogenesis protein NfuA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A8H9T3 1.34e-107 309 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q8E8P2 7.27e-107 307 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RE77 1.5e-106 306 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain W3-18-1)
A4YC18 1.5e-106 306 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q7VNV0 2.04e-106 306 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A9KUY3 2.17e-106 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS195)
A6WU19 2.17e-106 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS185)
A3CYW3 2.17e-106 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8ECN4 2.17e-106 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS223)
B8CUY8 2.3e-106 306 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella piezotolerans (strain WP3 / JCM 13877)
Q0HPU8 2.92e-106 305 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-7)
B0TNS0 3.6e-106 305 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella halifaxensis (strain HAW-EB4)
C4LA10 7.18e-106 304 74 0 192 3 nfuA Fe/S biogenesis protein NfuA Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q0HDK0 1.07e-105 304 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-4)
A0L2F1 1.07e-105 304 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain ANA-3)
A3Q930 1.6e-105 303 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q089F8 3.22e-105 303 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella frigidimarina (strain NCIMB 400)
Q15N06 4.1e-105 303 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A0KF09 5.58e-105 302 74 0 192 3 nfuA Fe/S biogenesis protein NfuA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4ST19 1.09e-104 301 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Aeromonas salmonicida (strain A449)
B1KM47 2.2e-104 301 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella woodyi (strain ATCC 51908 / MS32)
A8FPL9 3.6e-104 300 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sediminis (strain HAW-EB3)
Q48AC6 9.74e-103 296 70 0 192 3 nfuA Fe/S biogenesis protein NfuA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SBE8 4.77e-101 292 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q12IC3 1.07e-100 291 70 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QZC8 1.04e-99 289 71 0 192 3 nfuA Fe/S biogenesis protein NfuA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A1SZH4 1.3e-95 278 66 0 192 3 nfuA Fe/S biogenesis protein NfuA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q3IJQ5 7.93e-92 269 65 1 192 3 nfuA Fe/S biogenesis protein NfuA Pseudoalteromonas translucida (strain TAC 125)
Q1LSZ3 2.01e-76 230 56 2 192 3 nfuA Fe/S biogenesis protein NfuA Baumannia cicadellinicola subsp. Homalodisca coagulata
Q9I2P8 1.39e-70 215 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KZ2 1.39e-70 215 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VB28 1.39e-70 215 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain LESB58)
A6V6X0 1.39e-70 215 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain PA7)
B8D9W6 6.31e-69 211 52 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D868 6.47e-68 208 51 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57609 6.47e-68 208 51 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
C1DLW0 1.83e-66 205 50 3 193 3 nfuA Fe/S biogenesis protein NfuA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
C5BJC0 2.09e-66 204 49 2 192 3 nfuA Fe/S biogenesis protein NfuA Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q492A3 3.05e-66 204 51 2 197 3 nfuA Fe/S biogenesis protein NfuA Blochmanniella pennsylvanica (strain BPEN)
Q8K934 7.35e-65 201 50 2 193 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89A55 2.91e-63 196 50 1 192 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q88KB2 9.25e-63 195 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W5N3 9.25e-63 195 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KKI2 1.33e-62 195 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain GB-1)
Q3KBL2 2.01e-62 194 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain Pf0-1)
B1J6F5 2.19e-62 194 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain W619)
C3K9S0 3.66e-62 194 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain SBW25)
A4XUA5 5.42e-62 193 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas mendocina (strain ymp)
A4VLM9 6.74e-61 191 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Stutzerimonas stutzeri (strain A1501)
Q4KAH1 8.76e-61 190 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1I898 2.37e-60 189 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas entomophila (strain L48)
Q056Z1 2.19e-59 187 46 3 194 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q6FDB8 1.68e-56 180 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q881Z4 3.7e-56 179 50 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48IG5 3.7e-56 179 50 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZTL7 3.82e-56 179 50 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas syringae pv. syringae (strain B728a)
B0V9L0 4.99e-56 179 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AYE)
A3M3B7 4.99e-56 179 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HVD2 4.99e-56 179 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain ACICU)
B7I8Q3 4.99e-56 179 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AB0057)
B7GXX8 4.99e-56 179 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AB307-0294)
B0VSR5 7.39e-56 178 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain SDF)
Q9EXI9 3.09e-55 173 85 0 100 3 nfuA Fe/S biogenesis protein NfuA (Fragment) Klebsiella pneumoniae
Q7VRN1 5.13e-54 174 43 4 205 3 nfuA Fe/S biogenesis protein NfuA Blochmanniella floridana
B4SPV3 8.47e-52 167 44 3 193 3 nfuA Fe/S biogenesis protein NfuA Stenotrophomonas maltophilia (strain R551-3)
Q8P8Z9 1.21e-51 167 43 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UUW4 1.21e-51 167 43 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain 8004)
Q8PKQ2 1.32e-51 167 43 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas axonopodis pv. citri (strain 306)
B2FM87 2.46e-51 166 44 3 193 3 nfuA Fe/S biogenesis protein NfuA Stenotrophomonas maltophilia (strain K279a)
Q3BSV3 4.53e-51 166 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2STN5 6.21e-51 166 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P1A3 7.63e-51 165 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B0RTH4 7.1e-50 163 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain B100)
Q87A52 1.91e-49 162 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9W5 1.91e-49 162 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain M23)
Q9PAB5 2.68e-49 161 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain 9a5c)
B0U5V3 3.59e-49 161 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain M12)
A1AW72 7.52e-42 142 39 2 192 3 nfuA Fe/S biogenesis protein NfuA Ruthia magnifica subsp. Calyptogena magnifica
A5CX22 3.17e-37 130 35 2 192 3 nfuA Fe/S biogenesis protein NfuA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q8D2Q3 1.01e-25 100 33 2 192 3 nfuA Fe/S biogenesis protein NfuA Wigglesworthia glossinidia brevipalpis
Q0ABJ8 1.87e-06 48 31 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q9C8J2 2.56e-06 50 30 4 113 2 NIFU5 NifU-like protein 5, mitochondrial Arabidopsis thaliana
Q9LIG6 2.63e-06 50 31 4 113 2 NIFU4 NifU-like protein 4, mitochondrial Arabidopsis thaliana
Q0VSN8 3.43e-06 47 29 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A4T031 3.69e-06 47 35 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q60AU6 1.42e-05 46 30 2 96 3 erpA2 Iron-sulfur cluster insertion protein ErpA 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1WVE3 1.94e-05 45 29 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Halorhodospira halophila (strain DSM 244 / SL1)
Q2KV08 3.44e-05 45 33 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella avium (strain 197N)
A9I246 4.48e-05 44 32 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q8DBX7 4.95e-05 44 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain CMCP6)
A1TYH3 4.97e-05 44 31 2 95 3 erpA Iron-sulfur cluster insertion protein ErpA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1TUF2 7.49e-05 43 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paracidovorax citrulli (strain AAC00-1)
A1WL78 7.8e-05 43 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Verminephrobacter eiseniae (strain EF01-2)
Q47IC1 7.81e-05 43 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Dechloromonas aromatica (strain RCB)
A1W3Q0 8.12e-05 43 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Acidovorax sp. (strain JS42)
Q7CQ12 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFZ8 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella typhi
B4TRX3 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella schwarzengrund (strain CVM19633)
B5BAW8 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain AKU_12601)
C0PYK9 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella paratyphi C (strain RKS4594)
A9N1X7 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PNG5 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TDB4 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella heidelberg (strain SL476)
B5RD10 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R5A0 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella enteritidis PT4 (strain P125109)
B5FR83 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella dublin (strain CT_02021853)
Q57LH1 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella choleraesuis (strain SC-B67)
A9MHJ6 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F1B8 8.69e-05 43 31 2 98 3 iscA Iron-binding protein IscA Salmonella agona (strain SL483)
B4RWS2 0.000123 43 29 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B5XNJ9 0.000126 43 30 2 98 3 iscA Iron-binding protein IscA Klebsiella pneumoniae (strain 342)
Q220S8 0.000148 43 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B4T0S0 0.000165 42 31 2 98 3 iscA Iron-binding protein IscA Salmonella newport (strain SL254)
A6TCE9 0.000179 42 30 2 98 3 iscA Iron-binding protein IscA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q7MHZ0 0.000185 42 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain YJ016)
Q7NRT6 0.000187 42 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4G1T7 0.000215 42 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Herminiimonas arsenicoxydans
A9C177 0.000216 42 29 2 95 3 erpA Putative iron-sulfur cluster insertion protein ErpA Delftia acidovorans (strain DSM 14801 / SPH-1)
Q124P0 0.000237 42 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q5P7U0 0.00026 42 29 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7VUW2 0.000344 42 31 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z5 0.000344 42 31 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC7 0.000344 42 31 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3SF18 0.000373 42 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Thiobacillus denitrificans (strain ATCC 25259)
A1K969 0.000384 42 28 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Azoarcus sp. (strain BH72)
B6EL03 0.000399 42 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio salmonicida (strain LFI1238)
B4EUE2 0.000423 41 25 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Proteus mirabilis (strain HI4320)
Q2S8Y5 0.000528 41 31 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Hahella chejuensis (strain KCTC 2396)
A7MGY0 0.000586 41 30 2 98 3 iscA Iron-binding protein IscA Cronobacter sakazakii (strain ATCC BAA-894)
O67709 0.000614 41 26 3 101 1 aq_1857 Protein aq_1857 Aquifex aeolicus (strain VF5)
Q1QSB5 0.000625 41 29 2 94 3 erpA Iron-sulfur cluster insertion protein ErpA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1VJJ5 0.000635 41 28 2 96 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Polaromonas naphthalenivorans (strain CJ2)
P46052 0.000725 41 34 3 100 2 hesB2 Protein HesB, vegetative Trichormus variabilis (strain ATCC 29413 / PCC 7937)
A4WDA9 0.00073 40 28 1 96 3 iscA Iron-binding protein IscA Enterobacter sp. (strain 638)
Q44540 0.000752 40 29 3 99 3 None Uncharacterized protein in nifU 5'region Azotobacter vinelandii
A7MUU6 0.000819 40 26 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio campbellii (strain ATCC BAA-1116)
Q1BZ43 0.001 40 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain AU 1054)
B1JVU6 0.001 40 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain MC0-3)
B4EET4 0.001 40 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4K7 0.001 40 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain HI2424)
Q2SZ67 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW5 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain K96243)
A3NDG6 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 668)
Q3JNR3 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1710b)
A3NZ78 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1106a)
A1V053 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain SAVP1)
Q62HB8 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain ATCC 23344)
A2S583 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10229)
A3MP61 0.001 40 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10247)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_15035
Feature type CDS
Gene nfuA
Product NfuA family Fe-S biogenesis protein
Location 107665 - 108243 (strand: -1)
Length 579 (nucleotides) / 192 (amino acids)

Contig

Accession ZDB_225
Length 129223 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1623
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01106 NifU-like domain
PF01521 Iron-sulphur cluster biosynthesis

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0694 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07400 Fe/S biogenesis protein NfuA - -

Protein Sequence

MITITDAAQAHFSKLLANQEPGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALPFEQLTAYVDELSAPFLDEAVIDFVTDQLGSQLTLKAPNAKMRKVADDAPLIERVEYVLQSQINPQLAGHGGRVSLMEITDEGYAILQFGGGCNGCSMVDVTLKEGIEKELLNMFAGELKGVKDLTEHQRGEHSYY

Flanking regions ( +/- flanking 50bp)

ATGGGCGTATTATAACCAACCGGAACAGTCAACTATTTTTGGGCAATGTTATGATTACTATTACTGACGCTGCGCAGGCACATTTTTCCAAACTGCTTGCCAACCAGGAACCCGGCACACAAATCCGTGTTTTTGTTATTAACCCGGGCACTCCCAATGCGGAATGCGGAGTCTCTTATTGTCCGCCTGATGCTGTGGAAGCGACCGATACCGCGCTGCCGTTTGAGCAGCTGACCGCCTATGTTGATGAACTGAGCGCACCGTTCCTTGACGAAGCCGTGATCGACTTCGTGACCGATCAGCTCGGCTCTCAGCTCACCTTAAAAGCCCCGAACGCCAAAATGCGTAAAGTGGCGGATGATGCCCCGCTGATCGAGCGTGTCGAGTACGTTCTGCAATCTCAGATCAACCCGCAGCTGGCCGGGCACGGCGGCCGTGTTTCCCTGATGGAAATCACGGACGAAGGCTATGCCATCCTCCAGTTCGGCGGCGGCTGTAACGGCTGCTCCATGGTGGATGTCACCCTGAAAGAAGGGATCGAAAAAGAGTTACTGAATATGTTTGCCGGTGAACTGAAAGGCGTTAAAGACCTGACTGAACATCAGCGCGGCGAACACTCTTATTACTGATAGTGCTGTACCGGCCGGATATCGCACGGCCGTGATAATACACTGCCCGG