Homologs in group_1665

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10700 FBDBKF_10700 94.8 Morganella morganii S1 nfuA NfuA family Fe-S biogenesis protein
EHELCC_15035 EHELCC_15035 94.8 Morganella morganii S2 nfuA NfuA family Fe-S biogenesis protein
NLDBIP_14865 NLDBIP_14865 94.8 Morganella morganii S4 nfuA NfuA family Fe-S biogenesis protein
LHKJJB_14480 LHKJJB_14480 94.8 Morganella morganii S3 nfuA NfuA family Fe-S biogenesis protein
HKOGLL_13100 HKOGLL_13100 94.8 Morganella morganii S5 nfuA NfuA family Fe-S biogenesis protein
PMI_RS14465 PMI_RS14465 86.5 Proteus mirabilis HI4320 nfuA Fe-S biogenesis protein NfuA

Distribution of the homologs in the orthogroup group_1665

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1665

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N9W2 5.17e-128 360 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TF37 1.12e-126 357 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTS2 1.12e-126 357 90 1 192 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae (strain 342)
A9MMB3 6.45e-126 355 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q3YWL1 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella sonnei (strain Ss046)
P63023 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella flexneri
Q0SZQ1 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella flexneri serotype 5b (strain 8401)
Q32AM7 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella dysenteriae serotype 1 (strain Sd197)
Q31VL8 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella boydii serotype 4 (strain Sb227)
B2U3M4 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LSB7 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5M0 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain UTI89 / UPEC)
B1LHL4 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain SMS-3-5 / SECEC)
B6I2X8 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain SE11)
B7NE19 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P63020 1.98e-125 354 89 1 192 1 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12)
B1IP51 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P63021 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TC53 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGT8 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O1:K1 / APEC
A8A5M2 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O9:H4 (strain HS)
B1X760 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12 / DH10B)
C4ZVW3 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1X0 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O8 (strain IAI1)
B7N147 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O81 (strain ED1a)
B5YTW5 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P63022 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O157:H7
B7L4U4 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain 55989 / EAEC)
B7MDP0 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKB9 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSU3 1.98e-125 354 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8ZLI7 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TY71 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella schwarzengrund (strain CVM19633)
C0Q0I7 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi C (strain RKS4594)
A9MTT1 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SVL5 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella newport (strain SL254)
B4TKT8 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella heidelberg (strain SL476)
B5R7K3 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R371 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella enteritidis PT4 (strain P125109)
B5FKD2 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella dublin (strain CT_02021853)
Q57IW3 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella choleraesuis (strain SC-B67)
B5F8M8 2.35e-125 353 89 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella agona (strain SL483)
B4EZM8 2.49e-125 353 86 0 192 3 nfuA Fe/S biogenesis protein NfuA Proteus mirabilis (strain HI4320)
A8AQW7 7.53e-125 352 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z223 8.5e-125 352 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella typhi
B7NMH9 1e-124 352 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5BHG9 1.14e-124 352 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi A (strain AKU_12601)
Q5PLY6 1.14e-124 352 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A4WFK2 1.79e-124 351 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Enterobacter sp. (strain 638)
A7ME80 3.03e-124 351 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Cronobacter sakazakii (strain ATCC BAA-894)
A1JSF6 3.1e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JHZ3 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664J6 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGR7 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis (strain Pestoides F)
Q1CCL5 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4D2 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJI0 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis
B2K5V9 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2L8 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNW0 4.36e-123 348 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GKT7 5.43e-123 348 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Serratia proteamaculans (strain 568)
C6DH68 3.21e-122 346 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
C5BGT5 6.2e-122 345 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Edwardsiella ictaluri (strain 93-146)
Q6CZL7 2.94e-121 343 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NQH5 3.01e-120 341 84 1 192 3 nfuA Fe/S biogenesis protein NfuA Sodalis glossinidius (strain morsitans)
B2VJW0 5.76e-118 335 82 1 192 3 nfuA Fe/S biogenesis protein NfuA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9CKP9 8.8e-111 317 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Pasteurella multocida (strain Pm70)
C4K405 4.63e-110 315 78 1 192 3 nfuA Fe/S biogenesis protein NfuA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
P31774 1.95e-109 313 72 0 191 1 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGU4 2.38e-109 313 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain PittGG)
A5UA56 2.38e-109 313 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain PittEE)
Q4QNB2 2.38e-109 313 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain 86-028NP)
B6ENV8 1.18e-108 311 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio salmonicida (strain LFI1238)
B5FCD0 1.25e-108 311 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio fischeri (strain MJ11)
Q5E1Z0 1.25e-108 311 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio fischeri (strain ATCC 700601 / ES114)
C3LSE7 2.55e-108 311 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain M66-2)
Q9KNL2 2.55e-108 311 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q65QC1 6.06e-108 310 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A5F4R9 3.95e-107 308 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B8CUY8 5.06e-107 307 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H9T3 5.71e-107 307 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TNS0 6.8e-107 307 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella halifaxensis (strain HAW-EB4)
B0BS54 8.77e-107 307 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZZ1 8.77e-107 307 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYM1 8.77e-107 307 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A7MST1 1.04e-106 306 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio campbellii (strain ATCC BAA-1116)
A6VL27 1.22e-106 306 71 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C4LA10 1.23e-106 306 75 0 192 3 nfuA Fe/S biogenesis protein NfuA Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B0URV5 1.23e-106 306 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Histophilus somni (strain 2336)
Q0I5I6 1.23e-106 306 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Histophilus somni (strain 129Pt)
Q87TC4 5.08e-106 305 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B4S1U9 7.67e-106 304 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q6LVQ9 1.79e-105 303 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Photobacterium profundum (strain SS9)
A3Q930 2.08e-105 303 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7MPY4 4.8e-105 302 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio vulnificus (strain YJ016)
Q8DDU2 4.8e-105 302 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio vulnificus (strain CMCP6)
Q089F8 7.5e-105 302 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella frigidimarina (strain NCIMB 400)
A1RE77 1.71e-104 301 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain W3-18-1)
A4YC18 1.71e-104 301 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q0HPU8 2.24e-104 301 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-7)
Q8E8P2 2.73e-104 300 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KUY3 3.22e-104 300 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS195)
A6WU19 3.22e-104 300 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS185)
A3CYW3 3.22e-104 300 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8ECN4 3.22e-104 300 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS223)
Q15N06 3.37e-104 300 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q7VNV0 4.43e-104 300 70 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A4ST19 5e-104 300 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Aeromonas salmonicida (strain A449)
B1KM47 1.86e-103 298 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella woodyi (strain ATCC 51908 / MS32)
A0KF09 2.37e-103 298 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q0HDK0 3.79e-103 298 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-4)
A0L2F1 3.79e-103 298 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain ANA-3)
Q12IC3 3.92e-102 295 71 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QZC8 1.16e-101 294 71 0 192 3 nfuA Fe/S biogenesis protein NfuA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A8FPL9 2.39e-101 293 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sediminis (strain HAW-EB3)
A1SBE8 2.28e-100 290 71 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q48AC6 6.12e-99 287 68 0 192 3 nfuA Fe/S biogenesis protein NfuA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A1SZH4 2.01e-94 275 65 0 192 3 nfuA Fe/S biogenesis protein NfuA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q3IJQ5 1.12e-92 271 65 1 192 3 nfuA Fe/S biogenesis protein NfuA Pseudoalteromonas translucida (strain TAC 125)
Q1LSZ3 3.55e-81 242 59 2 192 3 nfuA Fe/S biogenesis protein NfuA Baumannia cicadellinicola subsp. Homalodisca coagulata
Q9I2P8 5.97e-72 219 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KZ2 5.97e-72 219 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VB28 5.97e-72 219 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain LESB58)
A6V6X0 5.97e-72 219 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain PA7)
B8D9W6 4.65e-69 211 52 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D868 4.27e-68 209 51 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57609 4.27e-68 209 51 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
C1DLW0 6.54e-68 208 51 3 193 3 nfuA Fe/S biogenesis protein NfuA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q492A3 1.08e-67 208 51 2 197 3 nfuA Fe/S biogenesis protein NfuA Blochmanniella pennsylvanica (strain BPEN)
C5BJC0 1.05e-66 205 49 2 192 3 nfuA Fe/S biogenesis protein NfuA Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8K934 6.36e-66 203 51 2 193 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q88KB2 8.38e-64 198 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W5N3 8.38e-64 198 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KKI2 9.97e-64 198 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain GB-1)
B1J6F5 1.94e-63 197 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain W619)
Q3KBL2 2.42e-62 194 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain Pf0-1)
C3K9S0 4.55e-62 194 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain SBW25)
A4XUA5 7.04e-62 193 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas mendocina (strain ymp)
Q89A55 1.08e-61 192 50 1 192 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q1I898 1.72e-61 192 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas entomophila (strain L48)
A4VLM9 5.85e-61 191 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Stutzerimonas stutzeri (strain A1501)
Q4KAH1 7.86e-61 191 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q056Z1 4.46e-60 188 45 3 194 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q7VRN1 1.71e-58 185 45 4 205 3 nfuA Fe/S biogenesis protein NfuA Blochmanniella floridana
Q6FDB8 5.99e-58 184 47 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B0V9L0 2.94e-57 182 48 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AYE)
A3M3B7 2.94e-57 182 48 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HVD2 2.94e-57 182 48 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain ACICU)
B7I8Q3 2.94e-57 182 48 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AB0057)
B7GXX8 2.94e-57 182 48 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AB307-0294)
B0VSR5 9.6e-56 178 47 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain SDF)
Q9EXI9 2.43e-55 173 85 0 100 3 nfuA Fe/S biogenesis protein NfuA (Fragment) Klebsiella pneumoniae
Q881Z4 5.29e-55 176 48 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48IG5 5.29e-55 176 48 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZTL7 5.34e-55 176 48 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas syringae pv. syringae (strain B728a)
B4SPV3 1.1e-51 167 43 3 193 3 nfuA Fe/S biogenesis protein NfuA Stenotrophomonas maltophilia (strain R551-3)
B2FM87 3.85e-51 166 43 3 193 3 nfuA Fe/S biogenesis protein NfuA Stenotrophomonas maltophilia (strain K279a)
Q3BSV3 9.59e-51 165 41 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2STN5 1.36e-50 164 41 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P1A3 1.75e-50 164 41 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PKQ2 4.85e-50 163 40 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas axonopodis pv. citri (strain 306)
Q8P8Z9 5.29e-50 163 40 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UUW4 5.29e-50 163 40 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain 8004)
B0RTH4 2.57e-48 159 40 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain B100)
Q87A52 5.27e-48 158 40 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9W5 5.27e-48 158 40 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain M23)
B0U5V3 8.32e-48 157 40 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain M12)
Q9PAB5 2.47e-47 156 40 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain 9a5c)
A1AW72 2.1e-43 146 40 2 192 3 nfuA Fe/S biogenesis protein NfuA Ruthia magnifica subsp. Calyptogena magnifica
A5CX22 1.05e-38 134 36 2 192 3 nfuA Fe/S biogenesis protein NfuA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q8D2Q3 4.31e-28 107 35 2 192 3 nfuA Fe/S biogenesis protein NfuA Wigglesworthia glossinidia brevipalpis
Q0ABJ8 2.9e-07 50 31 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A4T031 3.24e-07 50 36 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q60AU6 1.9e-06 48 31 2 96 3 erpA2 Iron-sulfur cluster insertion protein ErpA 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q9C8J2 2e-06 50 30 3 111 2 NIFU5 NifU-like protein 5, mitochondrial Arabidopsis thaliana
Q2KV08 4.57e-06 47 34 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella avium (strain 197N)
A9I246 5.78e-06 47 34 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1TYH3 6.05e-06 46 31 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1WVE3 7.13e-06 47 29 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Halorhodospira halophila (strain DSM 244 / SL1)
Q9LIG6 7.62e-06 48 30 3 111 2 NIFU4 NifU-like protein 4, mitochondrial Arabidopsis thaliana
Q47IC1 1.19e-05 46 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Dechloromonas aromatica (strain RCB)
A1W3Q0 1.3e-05 46 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Acidovorax sp. (strain JS42)
A1TUF2 1.45e-05 45 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paracidovorax citrulli (strain AAC00-1)
Q0VSN8 1.65e-05 45 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1WL78 1.69e-05 45 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Verminephrobacter eiseniae (strain EF01-2)
Q220S8 2.75e-05 45 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q7VUW2 3.8e-05 44 32 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z5 3.8e-05 44 32 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC7 3.8e-05 44 32 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A4G1T7 3.82e-05 44 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Herminiimonas arsenicoxydans
A9C177 3.95e-05 44 30 2 95 3 erpA Putative iron-sulfur cluster insertion protein ErpA Delftia acidovorans (strain DSM 14801 / SPH-1)
Q7NRT6 4.1e-05 44 32 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q124P0 4.35e-05 44 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2S8Y5 5.01e-05 44 32 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Hahella chejuensis (strain KCTC 2396)
Q8DBX7 5.1e-05 44 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain CMCP6)
Q84LK7 5.58e-05 45 36 3 77 1 NIFU1 NifU-like protein 1, chloroplastic Oryza sativa subsp. japonica
Q5P7U0 5.9e-05 44 30 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A1K969 6.08e-05 44 29 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Azoarcus sp. (strain BH72)
Q3SF18 6.46e-05 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Thiobacillus denitrificans (strain ATCC 25259)
Q93W20 7.57e-05 45 36 3 79 1 NIFU2 NifU-like protein 2, chloroplastic Arabidopsis thaliana
Q84RQ7 7.9e-05 45 37 3 79 2 NIFU3 NifU-like protein 3, chloroplastic Arabidopsis thaliana
A1VJJ5 0.000101 43 29 2 96 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Polaromonas naphthalenivorans (strain CJ2)
Q60C62 0.000102 43 31 2 96 3 erpA1 Iron-sulfur cluster insertion protein ErpA 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B6EL03 0.000106 43 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio salmonicida (strain LFI1238)
B4RWS2 0.000131 43 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A2SKL7 0.000184 42 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A6SUP2 0.000191 42 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Janthinobacterium sp. (strain Marseille)
Q7MHZ0 0.000204 42 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain YJ016)
B4EUE2 0.000295 42 25 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Proteus mirabilis (strain HI4320)
Q2NVP9 0.000346 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Sodalis glossinidius (strain morsitans)
O67709 0.000388 42 26 3 101 1 aq_1857 Protein aq_1857 Aquifex aeolicus (strain VF5)
A7MGY0 0.000421 41 29 2 98 3 iscA Iron-binding protein IscA Cronobacter sakazakii (strain ATCC BAA-894)
Q1QSB5 0.000487 41 29 2 94 3 erpA Iron-sulfur cluster insertion protein ErpA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q1BZ43 0.000565 41 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain AU 1054)
B1JVU6 0.000565 41 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain MC0-3)
B4EET4 0.000565 41 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4K7 0.000565 41 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain HI2424)
Q2SZ67 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW5 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain K96243)
A3NDG6 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 668)
Q3JNR3 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1710b)
A3NZ78 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1106a)
A1V053 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain SAVP1)
Q62HB8 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain ATCC 23344)
A2S583 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10229)
A3MP61 0.000652 41 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10247)
Q00241 0.000744 42 24 3 150 3 nifU Nitrogen fixation protein NifU (Fragment) Leptolyngbya boryana
Q21MI1 0.000748 41 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q6D1Z1 0.00076 41 25 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B4H303 0.000761 42 27 2 106 3 GL13432 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila persimilis
B2JGV0 0.000767 41 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B5DKJ8 0.000842 42 27 2 106 3 GA22888 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila pseudoobscura pseudoobscura
Q8Y242 0.000889 41 28 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A7MUU6 0.001 40 26 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio campbellii (strain ATCC BAA-1116)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14415
Feature type CDS
Gene nfuA
Product Fe-S biogenesis protein NfuA
Location 111031 - 111609 (strand: -1)
Length 579 (nucleotides) / 192 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1665
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01106 NifU-like domain
PF01521 Iron-sulphur cluster biosynthesis

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0694 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07400 Fe/S biogenesis protein NfuA - -

Protein Sequence

MITITDTAQAHFSKLLANQEPGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALPFEQLTAYVDELSAPYLEEAVIDFITDQLGSQLTLKAPNAKMRKVDDDAPLIERVEYVLQSQINPQLAGHGGRVSLMEITDDGFAILQFGGGCNGCSMVDVTLKEGIEKELLNMFPDELKGVKDLTEHQPGEHSYY

Flanking regions ( +/- flanking 50bp)

ATGGGCGTATTATAACCTACCAGAACAGTCAACTATTTTCGGGCAATGTTATGATTACTATTACTGACACTGCGCAGGCACATTTTTCCAAACTGCTTGCCAACCAGGAACCCGGTACACAAATCCGTGTTTTTGTTATTAATCCCGGTACACCCAATGCAGAATGTGGTGTCTCTTATTGTCCGCCGGATGCCGTTGAAGCGACGGATACCGCGCTGCCGTTTGAGCAACTGACCGCCTATGTCGATGAACTGAGCGCCCCGTACCTTGAAGAAGCCGTTATTGACTTCATCACTGACCAGCTCGGCTCTCAGCTCACCCTGAAAGCGCCGAATGCAAAAATGCGCAAGGTGGATGATGATGCTCCGCTGATCGAACGCGTCGAGTATGTCCTGCAATCTCAGATTAACCCGCAGTTGGCAGGTCACGGCGGTCGTGTTTCCCTGATGGAAATCACTGATGACGGGTTTGCTATCCTCCAGTTCGGCGGCGGATGTAACGGCTGCTCAATGGTCGATGTGACCCTGAAAGAAGGGATCGAAAAAGAGTTATTAAATATGTTCCCCGATGAGCTGAAAGGCGTTAAAGACCTGACTGAACATCAGCCCGGCGAACATTCTTATTACTGATTCGATTTAATTTACAGTATTTATACTCTAAATAATTCGGGATGCCTGTA