Homologs in group_1623

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10700 FBDBKF_10700 88.0 Morganella morganii S1 nfuA NfuA family Fe-S biogenesis protein
EHELCC_15035 EHELCC_15035 88.0 Morganella morganii S2 nfuA NfuA family Fe-S biogenesis protein
NLDBIP_14865 NLDBIP_14865 88.0 Morganella morganii S4 nfuA NfuA family Fe-S biogenesis protein
LHKJJB_14480 LHKJJB_14480 88.0 Morganella morganii S3 nfuA NfuA family Fe-S biogenesis protein
HKOGLL_13100 HKOGLL_13100 88.0 Morganella morganii S5 nfuA NfuA family Fe-S biogenesis protein
F4V73_RS14415 F4V73_RS14415 86.5 Morganella psychrotolerans nfuA Fe-S biogenesis protein NfuA

Distribution of the homologs in the orthogroup group_1623

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1623

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EZM8 6.65e-143 398 100 0 192 3 nfuA Fe/S biogenesis protein NfuA Proteus mirabilis (strain HI4320)
Q7N9W2 2.4e-126 356 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C5BGT5 2.63e-125 353 88 1 192 3 nfuA Fe/S biogenesis protein NfuA Edwardsiella ictaluri (strain 93-146)
Q3YWL1 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella sonnei (strain Ss046)
P63023 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella flexneri
Q0SZQ1 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella flexneri serotype 5b (strain 8401)
Q32AM7 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella dysenteriae serotype 1 (strain Sd197)
Q31VL8 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella boydii serotype 4 (strain Sb227)
B2U3M4 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LSB7 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R5M0 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain UTI89 / UPEC)
B1LHL4 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain SMS-3-5 / SECEC)
B6I2X8 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain SE11)
B7NE19 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P63020 3.69e-125 353 87 1 192 1 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12)
B1IP51 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P63021 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TC53 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGT8 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O1:K1 / APEC
A8A5M2 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O9:H4 (strain HS)
B1X760 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12 / DH10B)
C4ZVW3 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1X0 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O8 (strain IAI1)
B7N147 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O81 (strain ED1a)
B5YTW5 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P63022 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O157:H7
B7L4U4 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli (strain 55989 / EAEC)
B7MDP0 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKB9 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSU3 3.69e-125 353 87 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MMB3 1.77e-124 351 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B7NMH9 2.55e-124 351 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A6TF37 7.3e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XTS2 7.3e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Klebsiella pneumoniae (strain 342)
Q8ZLI7 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TY71 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella schwarzengrund (strain CVM19633)
C0Q0I7 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi C (strain RKS4594)
A9MTT1 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SVL5 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella newport (strain SL254)
B4TKT8 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella heidelberg (strain SL476)
B5R7K3 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R371 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella enteritidis PT4 (strain P125109)
B5FKD2 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella dublin (strain CT_02021853)
Q57IW3 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella choleraesuis (strain SC-B67)
B5F8M8 7.62e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella agona (strain SL483)
A8AQW7 7.88e-124 350 86 1 192 3 nfuA Fe/S biogenesis protein NfuA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8Z223 3.04e-123 348 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella typhi
B5BHG9 3.87e-123 348 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi A (strain AKU_12601)
Q5PLY6 3.87e-123 348 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A7ME80 6.91e-123 347 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Cronobacter sakazakii (strain ATCC BAA-894)
A4WFK2 1.49e-122 347 84 1 192 3 nfuA Fe/S biogenesis protein NfuA Enterobacter sp. (strain 638)
B1JHZ3 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q664J6 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TGR7 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis (strain Pestoides F)
Q1CCL5 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4D2 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZJI0 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis
B2K5V9 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C2L8 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNW0 1.03e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JSF6 1.16e-121 344 85 1 192 3 nfuA Fe/S biogenesis protein NfuA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NQH5 2.58e-120 341 83 1 192 3 nfuA Fe/S biogenesis protein NfuA Sodalis glossinidius (strain morsitans)
A8GKT7 3.71e-120 340 84 1 192 3 nfuA Fe/S biogenesis protein NfuA Serratia proteamaculans (strain 568)
C6DH68 5.27e-120 340 84 1 192 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VJW0 8.35e-120 340 82 1 192 3 nfuA Fe/S biogenesis protein NfuA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q6CZL7 4.94e-119 338 83 1 192 3 nfuA Fe/S biogenesis protein NfuA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P31774 1.62e-115 329 76 0 191 1 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGU4 2.25e-115 328 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain PittGG)
A5UA56 2.25e-115 328 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain PittEE)
Q4QNB2 2.25e-115 328 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus influenzae (strain 86-028NP)
A6VL27 1.11e-114 327 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9CKP9 1.81e-114 326 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Pasteurella multocida (strain Pm70)
Q65QC1 1.68e-113 324 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VNV0 1.07e-111 319 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BS54 2.18e-111 318 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZZ1 2.18e-111 318 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYM1 2.18e-111 318 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B5FCD0 9.71e-111 317 77 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio fischeri (strain MJ11)
Q5E1Z0 9.71e-111 317 77 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0URV5 5.3e-110 315 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Histophilus somni (strain 2336)
Q0I5I6 5.3e-110 315 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Histophilus somni (strain 129Pt)
B6ENV8 6.76e-110 315 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Aliivibrio salmonicida (strain LFI1238)
C4K405 1.36e-109 314 77 1 192 3 nfuA Fe/S biogenesis protein NfuA Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A8H9T3 5.35e-109 312 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B8CUY8 2.62e-108 310 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella piezotolerans (strain WP3 / JCM 13877)
B1KM47 1.62e-107 308 76 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella woodyi (strain ATCC 51908 / MS32)
B0TNS0 3.19e-107 308 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella halifaxensis (strain HAW-EB4)
Q0HPU8 9.66e-107 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-7)
A3Q930 1.09e-106 306 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HDK0 1.13e-106 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain MR-4)
A0L2F1 1.13e-106 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain ANA-3)
Q8E8P2 1.5e-106 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9KUY3 1.91e-106 306 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS195)
A6WU19 1.91e-106 306 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS185)
A3CYW3 1.91e-106 306 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8ECN4 1.91e-106 306 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella baltica (strain OS223)
Q87TC4 1.98e-106 306 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MPY4 2.78e-106 305 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio vulnificus (strain YJ016)
Q8DDU2 2.78e-106 305 74 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio vulnificus (strain CMCP6)
Q6LVQ9 3.42e-106 305 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Photobacterium profundum (strain SS9)
A7MST1 3.82e-106 305 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio campbellii (strain ATCC BAA-1116)
A8FPL9 5.06e-106 305 75 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sediminis (strain HAW-EB3)
A1RE77 6.65e-106 305 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella sp. (strain W3-18-1)
A4YC18 6.65e-106 305 73 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
C4LA10 6.73e-106 305 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q089F8 2.53e-105 303 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella frigidimarina (strain NCIMB 400)
A0KF09 6.15e-104 300 73 0 192 3 nfuA Fe/S biogenesis protein NfuA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B4S1U9 6.94e-104 299 70 0 192 3 nfuA Fe/S biogenesis protein NfuA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q15N06 8.09e-104 299 72 0 192 3 nfuA Fe/S biogenesis protein NfuA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A4ST19 1.4e-103 298 72 0 192 3 nfuA Fe/S biogenesis protein NfuA Aeromonas salmonicida (strain A449)
A1SBE8 3.12e-103 298 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
C3LSE7 6.89e-103 297 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain M66-2)
Q9KNL2 6.89e-103 297 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4R9 1.39e-102 296 72 0 191 3 nfuA Fe/S biogenesis protein NfuA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q12IC3 2.32e-102 295 71 0 191 3 nfuA Fe/S biogenesis protein NfuA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5QZC8 2.42e-102 295 72 0 192 3 nfuA Fe/S biogenesis protein NfuA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q48AC6 3.01e-102 295 71 0 192 3 nfuA Fe/S biogenesis protein NfuA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3IJQ5 2.27e-96 280 68 1 192 3 nfuA Fe/S biogenesis protein NfuA Pseudoalteromonas translucida (strain TAC 125)
A1SZH4 9.43e-95 276 66 0 192 3 nfuA Fe/S biogenesis protein NfuA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q1LSZ3 1.9e-76 230 56 2 192 3 nfuA Fe/S biogenesis protein NfuA Baumannia cicadellinicola subsp. Homalodisca coagulata
Q9I2P8 2.11e-72 220 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KZ2 2.11e-72 220 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VB28 2.11e-72 220 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain LESB58)
A6V6X0 2.11e-72 220 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas aeruginosa (strain PA7)
Q492A3 2.49e-69 212 54 3 197 3 nfuA Fe/S biogenesis protein NfuA Blochmanniella pennsylvanica (strain BPEN)
C1DLW0 2.66e-69 212 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B8D9W6 6.17e-69 211 52 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D868 1.35e-67 207 51 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57609 1.35e-67 207 51 3 195 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K934 5.63e-67 206 50 2 193 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C5BJC0 8.82e-66 203 48 2 192 3 nfuA Fe/S biogenesis protein NfuA Teredinibacter turnerae (strain ATCC 39867 / T7901)
B1J6F5 7.18e-65 201 54 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain W619)
Q88KB2 4.91e-64 199 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W5N3 4.91e-64 199 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KKI2 5.41e-64 198 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas putida (strain GB-1)
A4XUA5 1.86e-63 197 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas mendocina (strain ymp)
Q1I898 3.04e-62 194 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas entomophila (strain L48)
Q3KBL2 3.99e-62 194 53 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain Pf0-1)
A4VLM9 7.6e-62 193 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Stutzerimonas stutzeri (strain A1501)
Q4KAH1 1.63e-60 189 52 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q89A55 1.67e-60 189 48 1 192 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
C3K9S0 1.88e-60 189 51 2 192 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas fluorescens (strain SBW25)
Q056Z1 1.26e-58 185 46 3 194 3 nfuA Fe/S biogenesis protein NfuA Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q7VRN1 1.01e-56 180 46 4 205 3 nfuA Fe/S biogenesis protein NfuA Blochmanniella floridana
Q6FDB8 4.15e-56 179 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q881Z4 9.66e-56 177 49 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48IG5 9.66e-56 177 49 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZTL7 1.01e-55 177 49 3 195 3 nfuA Fe/S biogenesis protein NfuA Pseudomonas syringae pv. syringae (strain B728a)
B0V9L0 8.2e-55 176 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AYE)
A3M3B7 8.2e-55 176 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2HVD2 8.2e-55 176 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain ACICU)
B7I8Q3 8.2e-55 176 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AB0057)
B7GXX8 8.2e-55 176 46 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain AB307-0294)
Q9EXI9 5.24e-54 170 82 0 100 3 nfuA Fe/S biogenesis protein NfuA (Fragment) Klebsiella pneumoniae
B0VSR5 2.5e-53 172 45 3 196 3 nfuA Fe/S biogenesis protein NfuA Acinetobacter baumannii (strain SDF)
Q3BSV3 3.25e-52 169 43 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B2STN5 5.36e-52 168 43 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P1A3 6.25e-52 168 43 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PKQ2 1.48e-51 167 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas axonopodis pv. citri (strain 306)
Q8P8Z9 1.54e-51 167 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UUW4 1.54e-51 167 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain 8004)
B4SPV3 7.72e-51 165 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Stenotrophomonas maltophilia (strain R551-3)
B2FM87 2.27e-50 164 42 3 193 3 nfuA Fe/S biogenesis protein NfuA Stenotrophomonas maltophilia (strain K279a)
B0RTH4 9.95e-50 162 41 3 193 3 nfuA Fe/S biogenesis protein NfuA Xanthomonas campestris pv. campestris (strain B100)
Q87A52 3.84e-48 158 41 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I9W5 3.84e-48 158 41 3 193 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain M23)
B0U5V3 5.1e-48 158 41 4 196 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain M12)
Q9PAB5 6.07e-48 158 41 4 196 3 nfuA Fe/S biogenesis protein NfuA Xylella fastidiosa (strain 9a5c)
A1AW72 1.96e-45 151 40 2 192 3 nfuA Fe/S biogenesis protein NfuA Ruthia magnifica subsp. Calyptogena magnifica
A5CX22 3.63e-41 140 37 2 192 3 nfuA Fe/S biogenesis protein NfuA Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q8D2Q3 1.77e-25 100 33 2 192 3 nfuA Fe/S biogenesis protein NfuA Wigglesworthia glossinidia brevipalpis
Q0ABJ8 9.69e-09 54 32 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q60AU6 1.47e-08 54 32 2 96 3 erpA2 Iron-sulfur cluster insertion protein ErpA 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A4T031 5.99e-08 52 36 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A1W3Q0 2.15e-07 50 33 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Acidovorax sp. (strain JS42)
A1WL78 2.23e-07 50 33 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Verminephrobacter eiseniae (strain EF01-2)
A1TUF2 2.3e-07 50 33 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paracidovorax citrulli (strain AAC00-1)
A1WVE3 2.54e-07 50 30 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Halorhodospira halophila (strain DSM 244 / SL1)
Q220S8 4.24e-07 50 33 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9C177 5.24e-07 50 32 2 95 3 erpA Putative iron-sulfur cluster insertion protein ErpA Delftia acidovorans (strain DSM 14801 / SPH-1)
Q124P0 7.51e-07 49 32 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Polaromonas sp. (strain JS666 / ATCC BAA-500)
A4G1T7 1.35e-06 48 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Herminiimonas arsenicoxydans
Q2KV08 1.66e-06 48 33 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella avium (strain 197N)
A1VJJ5 2.08e-06 48 31 2 96 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Polaromonas naphthalenivorans (strain CJ2)
A9I246 2.16e-06 48 32 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1KSG6 2.85e-06 47 34 4 99 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DDN1 2.85e-06 47 34 4 99 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1IQG0 2.85e-06 47 34 4 99 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5F6W8 2.85e-06 47 34 4 99 3 erpA Putative iron-sulfur cluster insertion protein ErpA Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9C8J2 2.95e-06 49 34 2 78 2 NIFU5 NifU-like protein 5, mitochondrial Arabidopsis thaliana
A1TYH3 3.32e-06 47 31 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q4K514 4.01e-06 47 33 2 89 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9LIG6 4.19e-06 49 31 4 117 2 NIFU4 NifU-like protein 4, mitochondrial Arabidopsis thaliana
A6SUP2 6.79e-06 46 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Janthinobacterium sp. (strain Marseille)
Q3K5W6 8.15e-06 46 33 2 89 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain Pf0-1)
Q7NRT6 8.48e-06 46 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q2S8Y5 8.92e-06 46 31 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Hahella chejuensis (strain KCTC 2396)
Q0VSN8 9.73e-06 46 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C3K2Z6 9.88e-06 46 33 2 89 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas fluorescens (strain SBW25)
Q2NVP9 1.01e-05 46 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Sodalis glossinidius (strain morsitans)
B4EUE2 1.11e-05 46 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Proteus mirabilis (strain HI4320)
Q4ZMM4 1.12e-05 46 33 2 90 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. syringae (strain B728a)
Q889Z2 1.12e-05 46 33 2 90 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48NN6 1.12e-05 46 33 2 90 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A2SKL7 1.17e-05 46 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q7VUW2 1.22e-05 46 31 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z5 1.22e-05 46 31 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC7 1.22e-05 46 31 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7CR66 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XFF3 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella typhi
B4TXQ8 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella schwarzengrund (strain CVM19633)
A9N0Q2 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PD49 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUY6 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella newport (strain SL254)
B4TK32 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella heidelberg (strain SL476)
B5RHE2 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3G8 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella enteritidis PT4 (strain P125109)
B5FJ03 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella dublin (strain CT_02021853)
Q57T51 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella choleraesuis (strain SC-B67)
A9MPK5 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8R7 1.84e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Salmonella agona (strain SL483)
O67709 1.99e-05 45 26 2 97 1 aq_1857 Protein aq_1857 Aquifex aeolicus (strain VF5)
Q3Z5K1 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella sonnei (strain Ss046)
P0ACC6 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri
Q0T850 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella flexneri serotype 5b (strain 8401)
Q32JV2 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella dysenteriae serotype 1 (strain Sd197)
Q325Y3 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 4 (strain Sb227)
B2U301 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LWB7 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RG32 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain UTI89 / UPEC)
B1LGV9 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SMS-3-5 / SECEC)
B6HZD2 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain SE11)
B7N825 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0ACC3 2.03e-05 45 27 2 97 1 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12)
B1IQI4 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0ACC4 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TLH5 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A7K2 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O1:K1 / APEC
A7ZWA4 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O9:H4 (strain HS)
B1XD26 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / DH10B)
C4ZRP9 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M197 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O8 (strain IAI1)
B7MP18 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O81 (strain ED1a)
B7NIB9 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0D6 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0ACC5 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O157:H7
B7LGL8 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli (strain 55989 / EAEC)
B7MBD9 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIK3 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHP8 2.03e-05 45 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1IFY7 2.33e-05 45 32 2 89 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas entomophila (strain L48)
Q8EHC4 2.91e-05 45 30 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q88QQ5 2.91e-05 45 33 2 89 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q60C62 2.94e-05 45 30 2 96 3 erpA1 Iron-sulfur cluster insertion protein ErpA 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0HSF0 3.06e-05 45 30 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-7)
Q0HG57 3.06e-05 45 30 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain MR-4)
A0KZS2 3.06e-05 45 30 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain ANA-3)
A1RMG3 3.13e-05 45 30 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella sp. (strain W3-18-1)
A4Y4G8 3.13e-05 45 30 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q01195 3.26e-05 44 32 2 98 3 None Uncharacterized protein in nifU 5'region Cereibacter sphaeroides
Q1BZ43 3.54e-05 45 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain AU 1054)
B1JVU6 3.54e-05 45 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia orbicola (strain MC0-3)
B4EET4 3.54e-05 45 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4K7 3.54e-05 45 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia cenocepacia (strain HI2424)
B2JGV0 3.74e-05 44 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
C5BAP7 3.84e-05 44 27 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Edwardsiella ictaluri (strain 93-146)
A4VHK9 4.06e-05 44 33 2 89 3 erpA Iron-sulfur cluster insertion protein ErpA Stutzerimonas stutzeri (strain A1501)
Q5P7U0 4.45e-05 44 28 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6D1Z1 4.69e-05 44 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9L5J9 4.73e-05 44 31 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS195)
A6WKM0 4.73e-05 44 31 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS185)
A3D1R9 4.73e-05 44 31 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBT9 4.73e-05 44 31 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella baltica (strain OS223)
A7MGR3 5.3e-05 44 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Cronobacter sakazakii (strain ATCC BAA-894)
A8ALD2 5.63e-05 44 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q47IC1 5.72e-05 44 28 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Dechloromonas aromatica (strain RCB)
A8G9U9 6.1e-05 44 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Serratia proteamaculans (strain 568)
Q07YU9 6.46e-05 43 30 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella frigidimarina (strain NCIMB 400)
Q15YG5 6.61e-05 43 29 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9X4A0 6.82e-05 43 25 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q39JJ8 6.87e-05 44 29 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BI89 7.08e-05 44 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTD3 7.08e-05 44 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia ambifaria (strain MC40-6)
Q47VA3 7.4e-05 43 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C1DHX9 7.58e-05 43 32 2 89 3 erpA Iron-sulfur cluster insertion protein ErpA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A9AH79 7.6e-05 43 30 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia multivorans (strain ATCC 17616 / 249)
B2SYK8 7.64e-05 43 34 3 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q13UB4 7.64e-05 43 34 3 97 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Paraburkholderia xenovorans (strain LB400)
A4JBK6 7.99e-05 43 30 2 96 3 erpA1 Putative iron-sulfur cluster insertion protein ErpA 1 Burkholderia vietnamiensis (strain G4 / LMG 22486)
A7MGY0 9.23e-05 43 30 2 98 3 iscA Iron-binding protein IscA Cronobacter sakazakii (strain ATCC BAA-894)
A6T4W0 9.59e-05 43 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q93W20 9.79e-05 45 38 4 80 1 NIFU2 NifU-like protein 2, chloroplastic Arabidopsis thaliana
Q3YZ24 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Shigella sonnei (strain Ss046)
P0AAD1 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Shigella flexneri
Q32D36 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Shigella dysenteriae serotype 1 (strain Sd197)
Q31XW2 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Shigella boydii serotype 4 (strain Sb227)
B7LKB1 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LNI4 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli (strain SMS-3-5 / SECEC)
B6I5A0 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli (strain SE11)
B7N6B5 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AAC8 0.000114 43 30 2 98 1 iscA Iron-binding protein IscA Escherichia coli (strain K12)
B1IWD3 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AAC9 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEV7 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AE65 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O1:K1 / APEC
B1XB03 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / DH10B)
C4ZXA3 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M7N1 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O8 (strain IAI1)
B7MYG2 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O81 (strain ED1a)
B7NRH7 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P0AAD0 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O157:H7
B7LDC0 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli (strain 55989 / EAEC)
B7MIL8 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UGX4 0.000114 43 30 2 98 3 iscA Iron-binding protein IscA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q21MI1 0.000115 43 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q2SZ67 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW5 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain K96243)
A3NDG6 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 668)
Q3JNR3 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1710b)
A3NZ78 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia pseudomallei (strain 1106a)
A1V053 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain SAVP1)
Q62HB8 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain ATCC 23344)
A2S583 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10229)
A3MP61 0.000121 43 31 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Burkholderia mallei (strain NCTC 10247)
B5FAL7 0.000125 43 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain MJ11)
Q5E2W7 0.000125 43 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5Y1L3 0.000128 43 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Klebsiella pneumoniae (strain 342)
B2UFK5 0.000148 43 28 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia pickettii (strain 12J)
Q3SF18 0.000152 43 29 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Thiobacillus denitrificans (strain ATCC 25259)
B4RWS2 0.000163 42 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B1JK20 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EE9 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPW8 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis (strain Pestoides F)
Q1CLU5 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E3 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Angola)
Q0WBQ9 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis
B2K550 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C3X3 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM07 0.000168 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N843 0.000177 42 26 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4XZB1 0.000187 42 31 2 85 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudomonas mendocina (strain ymp)
Q1GXC7 0.000213 42 27 2 96 3 erpA Putative iron-sulfur cluster insertion protein ErpA Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B2VE26 0.000218 42 25 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8H175 0.000222 42 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A3QBP0 0.000224 42 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B4M375 0.000226 44 31 1 80 3 GJ19011 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila virilis
Q5QVQ4 0.000231 42 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B3H296 0.000235 42 25 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q8DBX7 0.000237 42 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain CMCP6)
A1JJQ3 0.000256 42 25 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B0TIR0 0.000271 42 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella halifaxensis (strain HAW-EB4)
B3MRT7 0.000279 43 31 1 80 3 GF20932 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila ananassae
B0BR51 0.000308 42 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A1K969 0.000315 42 27 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Azoarcus sp. (strain BH72)
A1ST94 0.000316 42 27 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q84RQ7 0.000332 43 38 4 80 2 NIFU3 NifU-like protein 3, chloroplastic Arabidopsis thaliana
Q3IHQ0 0.000384 42 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Pseudoalteromonas translucida (strain TAC 125)
Q12KD2 0.000396 42 29 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q1QSB5 0.000399 42 29 2 94 3 erpA Iron-sulfur cluster insertion protein ErpA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B8CQR0 0.0004 42 28 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Shewanella piezotolerans (strain WP3 / JCM 13877)
B5EQH0 0.000485 42 28 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JAH6 0.000485 42 28 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A3N2B0 0.000488 41 24 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q8Y242 0.000505 41 27 2 97 3 erpA Putative iron-sulfur cluster insertion protein ErpA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6VN49 0.000528 41 24 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A4SJ82 0.000562 41 24 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas salmonicida (strain A449)
Q07184 0.000592 41 28 2 98 3 None Uncharacterized protein in nifU 5'region Rhodobacter capsulatus
B4JWR9 0.000599 43 30 1 80 3 GH17809 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila grimshawi
A0KNY6 0.000646 41 25 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B2AH60 0.000652 41 31 3 98 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q475T0 0.000652 41 31 3 98 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0KED6 0.000652 41 31 3 98 3 erpA Putative iron-sulfur cluster insertion protein ErpA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8SY96 0.000714 42 31 1 80 2 CG32500 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila melanogaster
Q31IS8 0.00072 41 23 2 97 3 erpA Iron-sulfur cluster insertion protein ErpA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B4PZ52 0.000791 42 31 1 80 3 GE15286 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila yakuba
B3NYF7 0.000799 42 31 1 80 3 GG17526 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila erecta
Q84LK7 0.000841 42 35 3 77 1 NIFU1 NifU-like protein 1, chloroplastic Oryza sativa subsp. japonica
B4IMF6 0.000861 42 31 1 80 3 GM13534 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila sechellia
Q7MHZ0 0.000879 40 26 2 96 3 erpA Iron-sulfur cluster insertion protein ErpA Vibrio vulnificus (strain YJ016)
Q9UUB8 0.001 42 30 1 71 3 SPBC1709.19c NifU-like protein C1709.19c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B4R3T1 0.001 42 31 1 80 3 GD15490 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila simulans
B4H303 0.001 42 30 1 80 3 GL13432 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila persimilis
B5DKJ8 0.001 42 30 1 80 3 GA22888 NFU1 iron-sulfur cluster scaffold homolog, mitochondrial Drosophila pseudoobscura pseudoobscura

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS14465
Feature type CDS
Gene nfuA
Product Fe-S biogenesis protein NfuA
Location 3208647 - 3209225 (strand: 1)
Length 579 (nucleotides) / 192 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1623
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01106 NifU-like domain
PF01521 Iron-sulphur cluster biosynthesis

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0694 Posttranslational modification, protein turnover, chaperones (O) O Fe-S cluster biogenesis protein NfuA, 4Fe-4S-binding domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07400 Fe/S biogenesis protein NfuA - -

Protein Sequence

MITITDAAQAHFAKLLANQEPNTQIRVFVINPGTPNAECGVSYCPPDAVEPNDTEIKFEKLSAYVDDISAPFLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLIERVEYVLQSQINPQLASHGGRVSLMEITEDGYAILQFGGGCNGCSMIDVTLKDGIEKELLNLFPEELKGVKDLTEHQRGDHSYY

Flanking regions ( +/- flanking 50bp)

ATTGGGCGTATGATAACCAACCAGAACAGTCAACTATTGAGCAAGACGATATGATTACTATTACTGATGCCGCACAGGCACACTTCGCCAAACTATTGGCTAATCAAGAACCCAATACTCAAATCCGTGTTTTTGTCATTAACCCAGGAACACCTAACGCTGAGTGTGGCGTTTCTTACTGTCCACCCGATGCAGTAGAGCCGAACGACACAGAAATTAAATTTGAAAAACTTTCTGCTTATGTTGATGACATCAGTGCACCTTTCTTAGAAGATGCAGAAATTGACTTTGTCACAGACCAATTAGGCTCACAATTAACATTAAAAGCACCTAATGCAAAAATGCGTAAAGTGGCTGACGATGCGCCTTTAATTGAACGTGTTGAATATGTACTGCAATCACAAATCAACCCACAGTTAGCGAGTCACGGTGGCCGCGTAAGCTTGATGGAAATCACTGAAGATGGCTATGCTATCTTACAATTCGGTGGTGGTTGTAATGGCTGCTCCATGATTGATGTCACTTTAAAAGATGGGATCGAAAAAGAGCTACTTAACCTGTTCCCAGAAGAGTTAAAAGGCGTGAAAGATTTAACCGAACACCAACGTGGTGATCACTCCTACTACTGATCCTCTATTACAAATCCCCTTTGATATTCACCTGCACAGATATCCTAGGG