Homologs in group_1749

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11910 FBDBKF_11910 100.0 Morganella morganii S1 idi isopentenyl-diphosphate Delta-isomerase
NLDBIP_15490 NLDBIP_15490 100.0 Morganella morganii S4 idi isopentenyl-diphosphate Delta-isomerase
LHKJJB_15120 LHKJJB_15120 100.0 Morganella morganii S3 idi isopentenyl-diphosphate Delta-isomerase
HKOGLL_14240 HKOGLL_14240 100.0 Morganella morganii S5 idi isopentenyl-diphosphate Delta-isomerase
F4V73_RS14745 F4V73_RS14745 82.6 Morganella psychrotolerans idi isopentenyl-diphosphate Delta-isomerase
PMI_RS13640 PMI_RS13640 49.7 Proteus mirabilis HI4320 idi isopentenyl-diphosphate Delta-isomerase

Distribution of the homologs in the orthogroup group_1749

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1749

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N0A6 3.09e-56 177 48 0 161 3 idi2 Isopentenyl-diphosphate Delta-isomerase 2 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GDW2 7.54e-56 176 50 0 163 3 idi Isopentenyl-diphosphate Delta-isomerase Serratia proteamaculans (strain 568)
A9AST0 4.54e-55 174 49 0 164 3 idi Isopentenyl-diphosphate Delta-isomerase Burkholderia multivorans (strain ATCC 17616 / 249)
Q5NWG5 3.38e-53 170 46 0 158 3 idi2 Isopentenyl-diphosphate Delta-isomerase 2 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6D3F5 1.35e-45 150 43 0 163 3 idi Isopentenyl-diphosphate Delta-isomerase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q6LUX5 2.23e-44 147 46 4 166 3 idi Isopentenyl-diphosphate Delta-isomerase Photobacterium profundum (strain SS9)
Q5E7U8 2.75e-43 145 43 3 172 3 idi Isopentenyl-diphosphate Delta-isomerase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5F9P6 8.89e-43 143 43 3 172 3 idi Isopentenyl-diphosphate Delta-isomerase Aliivibrio fischeri (strain MJ11)
Q5P011 3.97e-40 136 42 0 164 3 idi1 Isopentenyl-diphosphate Delta-isomerase 1 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9X7Q6 4.84e-38 132 48 5 160 3 idi Isopentenyl-diphosphate Delta-isomerase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9Z5D3 9.16e-38 130 46 3 145 3 idi Isopentenyl-diphosphate Delta-isomerase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PL07 9.16e-38 130 46 3 145 3 idi Isopentenyl-diphosphate Delta-isomerase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4WRA6 3.16e-37 129 45 4 153 3 idi Isopentenyl-diphosphate Delta-isomerase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q82MJ7 5.19e-37 129 44 4 160 3 idi Isopentenyl-diphosphate Delta-isomerase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B9KK15 5.55e-37 128 45 3 145 3 idi Isopentenyl-diphosphate Delta-isomerase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
B1VTW2 2.84e-36 127 44 4 160 3 idi Isopentenyl-diphosphate Delta-isomerase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q28W27 6.65e-35 123 40 3 157 3 idi Isopentenyl-diphosphate Delta-isomerase Jannaschia sp. (strain CCS1)
A1WXH5 9.25e-35 123 37 4 175 3 idi Isopentenyl-diphosphate Delta-isomerase Halorhodospira halophila (strain DSM 244 / SL1)
Q5LWT6 1.39e-34 122 43 3 152 3 idi Isopentenyl-diphosphate Delta-isomerase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
P26173 1.7e-33 119 44 4 147 1 idi Isopentenyl-diphosphate Delta-isomerase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A8LQ20 2.32e-33 119 45 4 153 3 idi Isopentenyl-diphosphate Delta-isomerase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q5YYB6 7.21e-32 115 38 2 157 3 idi Isopentenyl-diphosphate Delta-isomerase Nocardia farcinica (strain IFM 10152)
Q16DR2 5.54e-31 113 40 4 153 3 idi Isopentenyl-diphosphate Delta-isomerase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q38929 6.94e-31 116 37 5 189 1 IPP1 Isopentenyl-diphosphate Delta-isomerase I, chloroplastic Arabidopsis thaliana
Q7N1V4 6.64e-30 110 39 2 160 3 idi1 Isopentenyl-diphosphate Delta-isomerase 1 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
O48964 1.9e-29 111 36 6 189 2 IPI1 Isopentenyl-diphosphate Delta-isomerase I Camptotheca acuminata
O48965 1.92e-29 112 38 6 189 2 IPI2 Isopentenyl-diphosphate Delta-isomerase II Camptotheca acuminata
Q42553 2.93e-29 111 35 4 189 1 IPP2 Isopentenyl-diphosphate Delta-isomerase II, chloroplastic Arabidopsis thaliana
A0A7C9FSB8 6.33e-29 110 35 5 189 2 IDI Isopentenyl-diphosphate Delta-isomerase 1, chloroplastic Cannabis sativa
Q39472 6.75e-29 110 35 4 189 2 IPI1 Isopentenyl-diphosphate Delta-isomerase I Clarkia breweri
A9MRI5 9.11e-29 107 36 4 169 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A4WE41 2.14e-28 107 36 3 161 3 idi Isopentenyl-diphosphate Delta-isomerase Enterobacter sp. (strain 638)
Q10132 4.13e-28 107 36 4 188 2 idi1 Isopentenyl-diphosphate delta-isomerase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B5RE00 5.14e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5F5G3 5.6e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella agona (strain SL483)
Q8ZM82 6.11e-28 105 36 4 168 1 idi Isopentenyl-diphosphate Delta-isomerase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TUQ7 6.11e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella schwarzengrund (strain CVM19633)
B5BFK4 6.11e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella paratyphi A (strain AKU_12601)
C0PY11 6.11e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella paratyphi C (strain RKS4594)
Q5PL31 6.11e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TGV9 6.11e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella heidelberg (strain SL476)
B5QXG6 6.11e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella enteritidis PT4 (strain P125109)
B5FUF2 6.11e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella dublin (strain CT_02021853)
Q57K77 6.11e-28 105 36 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella choleraesuis (strain SC-B67)
Q8Z3X9 2.3e-27 104 35 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella typhi
I1RZ92 2.3e-27 106 36 4 185 3 IDI1 Isopentenyl-diphosphate delta-isomerase IDI1 Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1)
O35760 5.19e-27 104 35 6 190 2 Idi1 Isopentenyl-diphosphate Delta-isomerase 1 Rattus norvegicus
A9N3L5 7.67e-27 102 35 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T534 7.92e-27 102 35 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Salmonella newport (strain SL254)
A6TDP3 1.11e-26 102 35 3 165 3 idi Isopentenyl-diphosphate Delta-isomerase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XUF5 1.54e-26 102 35 3 165 3 idi Isopentenyl-diphosphate Delta-isomerase Klebsiella pneumoniae (strain 342)
O35586 1.72e-26 103 36 6 190 2 IDI1 Isopentenyl-diphosphate Delta-isomerase 1 Mesocricetus auratus
A8AP95 2.22e-26 101 36 3 164 3 idi Isopentenyl-diphosphate Delta-isomerase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q39471 7.37e-26 102 33 4 189 3 IPI2 Isopentenyl-diphosphate Delta-isomerase II Clarkia breweri
P58044 1.03e-25 101 35 6 190 1 Idi1 Isopentenyl-diphosphate Delta-isomerase 1 Mus musculus
A1R1M6 1.09e-25 100 35 4 172 3 idi Isopentenyl-diphosphate Delta-isomerase Paenarthrobacter aurescens (strain TC1)
Q8FE75 1.89e-25 99 36 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q31WF1 2.09e-25 99 36 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Shigella boydii serotype 4 (strain Sb227)
B6I722 2.09e-25 99 36 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli (strain SE11)
B7N7D3 2.11e-25 99 36 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q83MJ9 2.35e-25 99 36 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Shigella flexneri
Q0T107 2.35e-25 99 36 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Shigella flexneri serotype 5b (strain 8401)
P15496 3.86e-25 101 35 7 195 1 IDI1 Isopentenyl-diphosphate delta-isomerase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q39664 4.83e-25 100 33 4 189 3 IPI2 Isopentenyl-diphosphate Delta-isomerase II Clarkia xantiana
B1ITB3 9.78e-25 97 36 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7NW30 1.05e-24 97 36 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B2U0Q6 1.31e-24 97 36 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q0TDW3 1.62e-24 97 35 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1LR71 1.67e-24 97 36 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli (strain SMS-3-5 / SECEC)
Q32BV2 1.78e-24 96 35 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Shigella dysenteriae serotype 1 (strain Sd197)
Q1R7E2 2.28e-24 96 35 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli (strain UTI89 / UPEC)
A1AF79 2.28e-24 96 35 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O1:K1 / APEC
B7MZ42 2.28e-24 96 35 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O81 (strain ED1a)
B7MM76 2.28e-24 96 35 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q0RBQ7 2.33e-24 97 33 3 163 3 idi Isopentenyl-diphosphate Delta-isomerase Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q1LZ95 2.98e-24 97 33 4 188 2 IDI1 Isopentenyl-diphosphate Delta-isomerase 1 Bos taurus
O42641 3.67e-24 97 34 6 188 1 IDI Isopentenyl-diphosphate delta-isomerase Phaffia rhodozyma
Q5R8R6 5.23e-24 96 35 5 188 2 IDI1 Isopentenyl-diphosphate Delta-isomerase 1 Pongo abelii
Q46822 5.38e-24 95 35 2 164 1 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli (strain K12)
B1XEH6 5.38e-24 95 35 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli (strain K12 / DH10B)
C5A0G1 5.38e-24 95 35 2 164 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli (strain K12 / MC4100 / BW2952)
Q13907 6.75e-24 96 34 4 188 1 IDI1 Isopentenyl-diphosphate Delta-isomerase 1 Homo sapiens
Q3YXY0 1.01e-23 94 35 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Shigella sonnei (strain Ss046)
B7LYF3 1.01e-23 94 35 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O8 (strain IAI1)
B5YQ81 1.01e-23 94 35 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XD58 1.01e-23 94 35 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O157:H7
A7ZQZ8 1.01e-23 94 35 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q4R4W5 2.55e-23 95 34 5 188 2 IDI1 Isopentenyl-diphosphate Delta-isomerase 1 Macaca fascicularis
B7UHT8 4.12e-23 93 35 2 160 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q9KK75 4.54e-23 93 34 4 171 3 idi Isopentenyl-diphosphate Delta-isomerase Brevibacterium linens
Q8KP37 6.73e-23 93 33 3 169 3 idi Isopentenyl-diphosphate Delta-isomerase Agromyces mediolanus
Q7X5H2 9.29e-23 92 34 3 159 3 idi Isopentenyl-diphosphate Delta-isomerase Citrobacter freundii
A8A430 9.39e-23 92 35 2 166 3 idi Isopentenyl-diphosphate Delta-isomerase Escherichia coli O9:H4 (strain HS)
Q4WM52 2.27e-22 93 32 5 192 3 idi1 Isopentenyl-diphosphate delta-isomerase idi1 Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
Q9NH02 3.41e-22 92 32 6 191 2 ipi Isopentenyl-diphosphate Delta-isomerase Dictyostelium discoideum
A0A1D8PLI2 7.78e-22 92 32 6 204 3 IDI1 Isopentenyl-diphosphate delta-isomerase Candida albicans (strain SC5314 / ATCC MYA-2876)
A1T5G2 1.73e-21 89 36 3 140 3 idi Isopentenyl-diphosphate Delta-isomerase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A4FK76 1.83e-21 89 31 3 162 3 idi Isopentenyl-diphosphate Delta-isomerase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q6AC73 7.99e-20 84 33 2 163 3 idi Isopentenyl-diphosphate Delta-isomerase Leifsonia xyli subsp. xyli (strain CTCB07)
B0RIB7 7.69e-19 82 30 3 161 3 idi Isopentenyl-diphosphate Delta-isomerase Clavibacter sepedonicus
Q9BXS1 1.16e-18 82 31 4 188 1 IDI2 Isopentenyl-diphosphate delta-isomerase 2 Homo sapiens
Q6A5Z1 1.81e-18 81 30 3 166 3 idi Isopentenyl-diphosphate Delta-isomerase Cutibacterium acnes (strain DSM 16379 / KPA171202)
A5CV36 2.1e-18 81 29 3 161 3 idi Isopentenyl-diphosphate Delta-isomerase Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382)
B2GFH1 4.55e-18 80 32 3 161 3 idi Isopentenyl-diphosphate Delta-isomerase Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
P60923 6.33e-18 79 34 4 164 3 idi Isopentenyl-diphosphate Delta-isomerase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
C1AP18 2.3e-17 78 34 4 150 3 idi Isopentenyl-diphosphate Delta-isomerase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KJG2 2.3e-17 78 34 4 150 3 idi Isopentenyl-diphosphate Delta-isomerase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q8BFZ6 3.42e-17 79 31 5 184 2 Idi2 Isopentenyl-diphosphate delta-isomerase 2 Mus musculus
P9WKK5 4.24e-17 78 34 4 150 1 idi Isopentenyl-diphosphate Delta-isomerase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WKK4 4.24e-17 78 34 4 150 3 idi Isopentenyl-diphosphate Delta-isomerase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U3A5 4.24e-17 78 34 4 150 3 idi Isopentenyl-diphosphate Delta-isomerase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q9KWD1 1.74e-16 76 36 5 139 3 idi Isopentenyl-diphosphate Delta-isomerase Rhizobium rhizogenes
Q7VEU0 4.09e-16 75 33 4 150 3 idi Isopentenyl-diphosphate Delta-isomerase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q8FND7 2.26e-14 70 43 1 85 3 idi Isopentenyl-diphosphate Delta-isomerase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A4QG13 9.29e-14 68 42 1 85 3 idi Isopentenyl-diphosphate Delta-isomerase Corynebacterium glutamicum (strain R)
Q8NN99 1.45e-13 68 42 1 85 3 idi Isopentenyl-diphosphate Delta-isomerase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q9HP40 3.08e-12 65 28 4 168 3 idi Isopentenyl-diphosphate Delta-isomerase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Q9HUW9 2.81e-11 62 31 3 132 3 PA4841 Uncharacterized Nudix hydrolase PA4841 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5UX45 1.2e-08 55 28 5 172 3 idi Isopentenyl-diphosphate Delta-isomerase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q8Y9Z9 3.19e-08 53 31 2 120 3 lmo0368 Uncharacterized Nudix hydrolase lmo0368 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92ES1 5.2e-07 50 30 2 120 3 lin0387 Uncharacterized Nudix hydrolase lin0387 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8ZD12 2.78e-05 45 28 4 134 3 YPO2781 Uncharacterized Nudix hydrolase YPO2781/y1614/YP_2383 Yersinia pestis
Q8L831 3.05e-05 47 29 4 127 1 NUDT3 Nudix hydrolase 3 Arabidopsis thaliana
Q8PTX6 3.58e-05 45 24 4 153 1 MM_2582 Prenyl-diphosphate phosphatase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_14395
Feature type CDS
Gene idi
Product isopentenyl-diphosphate Delta-isomerase
Location 101726 - 102247 (strand: -1)
Length 522 (nucleotides) / 173 (amino acids)
In genomic island -

Contig

Accession ZDB_224
Length 134704 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1749
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00293 NUDIX domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1443 Lipid transport and metabolism (I) I Isopentenyldiphosphate isomerase

Kegg Ortholog Annotation(s)

Protein Sequence

MSDELILVDEHDNTLGYDEKLRVHQLGLLHRAFSVFLFNDTGELLIQQRALSKYHSGGLWANSCCSHPRRGESLEQATQRRLQEELGITCPLRPAGHIIYRANVPPSLTEHEYDHLFTGHYNGPFSLNPQEVAAVRWISLTDLKKEMHDHPQQFAEWFKVIAKKFPRLQITTS

Flanking regions ( +/- flanking 50bp)

CATATTTGCTACAGTATATCTTTCAGCCGCTTTACCGGATAAAAGATATAATGAGTGACGAACTGATTCTGGTCGATGAACATGATAATACCCTCGGGTATGACGAAAAACTCCGCGTTCATCAGCTCGGATTACTGCACCGTGCGTTTTCTGTGTTCCTGTTTAATGATACGGGTGAGCTGCTGATCCAGCAGCGCGCGCTCAGCAAATACCATTCCGGCGGATTGTGGGCCAACAGCTGCTGTAGTCATCCCCGCCGTGGTGAATCGCTGGAACAGGCGACACAGCGCCGTCTGCAGGAAGAGCTGGGGATCACCTGTCCTCTGCGGCCTGCCGGACATATCATTTATCGTGCGAATGTTCCGCCGTCCCTGACTGAACATGAATATGATCACCTGTTTACCGGCCACTATAACGGCCCGTTTTCCCTGAATCCGCAGGAGGTCGCTGCCGTACGCTGGATATCACTCACTGACCTGAAAAAAGAGATGCATGACCATCCGCAGCAATTTGCCGAATGGTTTAAGGTCATCGCCAAAAAATTCCCGCGGTTACAGATAACAACCTCATGACACTGATTACAGAAGAGCGTGCGCCTTCCGCACAGGAATACTGCACGCTG