Homologs in group_1772

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12330 FBDBKF_12330 100.0 Morganella morganii S1 cpxR envelope stress response regulator transcription factor CpxR
NLDBIP_15070 NLDBIP_15070 100.0 Morganella morganii S4 cpxR envelope stress response regulator transcription factor CpxR
LHKJJB_15540 LHKJJB_15540 100.0 Morganella morganii S3 cpxR envelope stress response regulator transcription factor CpxR
HKOGLL_14660 HKOGLL_14660 100.0 Morganella morganii S5 cpxR envelope stress response regulator transcription factor CpxR
F4V73_RS17160 F4V73_RS17160 97.0 Morganella psychrotolerans cpxR envelope stress response regulator transcription factor CpxR
PMI_RS15820 PMI_RS15820 90.5 Proteus mirabilis HI4320 cpxR envelope stress response regulator transcription factor CpxR

Distribution of the homologs in the orthogroup group_1772

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1772

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A0A0H3GGB5 1.05e-134 381 85 1 234 2 cpxR Transcriptional regulatory protein CpxR Klebsiella pneumoniae subsp. pneumoniae (strain HS11286)
P0AE90 2.72e-133 377 85 1 234 3 cpxR Transcriptional regulatory protein CpxR Shigella flexneri
P0AE88 2.72e-133 377 85 1 234 1 cpxR Transcriptional regulatory protein CpxR Escherichia coli (strain K12)
P0AE89 2.72e-133 377 85 1 234 3 cpxR Transcriptional regulatory protein CpxR Escherichia coli O157:H7
P44895 1.43e-80 243 58 1 232 3 cpxR Transcriptional regulatory protein CpxR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37478 9.48e-57 183 41 2 230 1 walR Transcriptional regulatory protein WalR Bacillus subtilis (strain 168)
Q4A160 1.38e-53 175 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8CQK0 3.51e-53 174 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HK18 3.51e-53 174 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P13792 9.31e-53 173 41 2 229 1 phoP Alkaline phosphatase synthesis transcriptional regulatory protein PhoP Bacillus subtilis (strain 168)
Q7A216 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MW2)
Q9RDT5 1.08e-52 172 39 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus
A8YYU1 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300 / TCH1516)
Q6GD72 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MSSA476)
Q6GKS7 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain MRSA252)
Q7A8E1 1.08e-52 172 39 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain N315)
Q99XF3 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QD57 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Newman)
Q5HJX7 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain COL)
Q2YUQ3 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5INQ9 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH9)
Q2G2U6 1.08e-52 172 39 3 229 1 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FKN8 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain USA300)
A6TXG8 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain JH1)
A7WWQ5 1.08e-52 172 39 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q4LAJ9 1.47e-52 172 38 3 229 3 walR Transcriptional regulatory protein WalR Staphylococcus haemolyticus (strain JCSC1435)
Q8DPL7 5.28e-51 168 39 2 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2UQ68 5.28e-51 168 39 2 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
A0A0H2ZN37 5.28e-51 168 39 2 231 1 walR Transcriptional regulatory protein WalR Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P48259 1.69e-48 162 42 4 233 3 ycf27 Probable transcriptional regulator ycf27 Cyanophora paradoxa
A0A4P7TS68 2.24e-48 162 40 3 231 1 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri serotype 5a (strain M90T)
P0AA21 2.24e-48 162 40 3 231 3 ompR DNA-binding dual transcriptional regulator OmpR Shigella flexneri
P0AA19 2.24e-48 162 40 3 231 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A0A0H3NGY1 2.24e-48 162 40 3 231 3 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhimurium (strain SL1344)
P0AA20 2.24e-48 162 40 3 231 1 ompR DNA-binding dual transcriptional regulator OmpR Salmonella typhi
P0AA16 2.24e-48 162 40 3 231 1 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli (strain K12)
P0AA17 2.24e-48 162 40 3 231 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AA18 2.24e-48 162 40 3 231 3 ompR DNA-binding dual transcriptional regulator OmpR Escherichia coli O157:H7
O78428 1.24e-47 160 42 4 233 3 ycf27 Probable transcriptional regulator ycf27 Guillardia theta
Q1XDC9 1.86e-45 154 39 4 233 3 ycf27 Probable transcriptional regulator ycf27 Neopyropia yezoensis
P51358 3.64e-45 154 39 4 233 3 ycf27 Probable transcriptional regulator ycf27 Porphyra purpurea
Q06239 8.08e-45 152 36 4 230 3 vanR Regulatory protein VanR Enterococcus faecium
P28835 1.1e-44 152 38 3 231 3 ycf27 Probable transcriptional regulator ycf27 Porphyridium aerugineum
P28257 8.61e-44 150 39 4 233 3 ycf27 Probable transcriptional regulator ycf27 Galdieria sulphuraria
A1TEL7 8.77e-44 150 39 5 231 3 mprA Response regulator MprA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
A0PWB4 9.62e-44 150 39 5 231 3 mprA Response regulator MprA Mycobacterium ulcerans (strain Agy99)
P45607 2.44e-43 149 39 5 231 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella flexneri
Q742C1 5.93e-43 147 39 5 231 3 mprA Response regulator MprA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QBQ9 5.93e-43 147 39 5 231 3 mprA Response regulator MprA Mycobacterium avium (strain 104)
A1KHB7 6.48e-43 147 39 5 231 3 mprA Response regulator MprA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7U0X4 6.48e-43 147 39 5 231 1 mprA Response regulator MprA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P69228 8.63e-43 147 37 2 227 1 baeR Transcriptional regulatory protein BaeR Escherichia coli (strain K12)
P69229 8.63e-43 147 37 2 227 1 baeR Transcriptional regulatory protein BaeR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P9WGM9 1.13e-42 147 39 5 231 1 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM8 1.13e-42 147 39 5 231 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U123 1.13e-42 147 39 5 231 3 mprA Response regulator MprA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
P94413 1.51e-42 146 35 4 228 3 yclJ Uncharacterized transcriptional regulatory protein YclJ Bacillus subtilis (strain 168)
Q9TLQ4 1.68e-42 147 37 3 235 3 ycf27 Probable transcriptional regulator ycf27 Cyanidium caldarium
P0AFJ5 2.4e-42 146 38 5 231 1 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli (strain K12)
P0AFJ6 2.4e-42 146 38 5 231 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Escherichia coli O157:H7
P45606 2.85e-42 146 38 5 231 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Shigella dysenteriae
A0R3I8 2.93e-42 146 39 5 231 1 mprA Response regulator MprA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P45605 8.28e-42 145 38 4 230 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Klebsiella pneumoniae
P31079 1.37e-41 144 37 3 234 3 petR Protein PetR Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q9CD68 2.17e-41 144 39 5 231 3 mprA Response regulator MprA Mycobacterium leprae (strain TN)
P9WGL9 4.21e-41 143 37 2 229 1 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGL8 4.21e-41 143 37 2 229 2 regX3 Sensory transduction protein RegX3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07130 4.21e-41 143 37 2 229 1 regX3 Sensory transduction protein RegX3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P42244 5.9e-41 142 35 2 225 3 ycbL Uncharacterized transcriptional regulatory protein YcbL Bacillus subtilis (strain 168)
Q1B3X8 8.35e-41 142 38 5 231 3 mprA Response regulator MprA Mycobacterium sp. (strain MCS)
A1UL70 8.35e-41 142 38 5 231 3 mprA Response regulator MprA Mycobacterium sp. (strain KMS)
A3Q5L9 8.35e-41 142 38 5 231 3 mprA Response regulator MprA Mycobacterium sp. (strain JLS)
P0C001 9.8e-41 142 37 5 232 3 arlR Response regulator ArlR Staphylococcus aureus (strain MW2)
Q6G9E6 9.8e-41 142 37 5 232 3 arlR Response regulator ArlR Staphylococcus aureus (strain MSSA476)
Q6GGZ3 9.8e-41 142 37 5 232 3 arlR Response regulator ArlR Staphylococcus aureus (strain MRSA252)
P0C000 9.8e-41 142 37 5 232 3 arlR Response regulator ArlR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HG04 9.8e-41 142 37 5 232 3 arlR Response regulator ArlR Staphylococcus aureus (strain COL)
Q2YY03 9.8e-41 142 37 5 232 3 arlR Response regulator ArlR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9KJN4 9.8e-41 142 37 5 232 1 arlR Response regulator ArlR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FH23 9.8e-41 142 37 5 232 3 arlR Response regulator ArlR Staphylococcus aureus (strain USA300)
Q9F868 3.49e-40 140 37 2 229 1 regX3 Sensory transduction protein RegX3 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P39663 4.61e-40 141 36 3 238 1 sphR Alkaline phosphatase synthesis transcriptional regulatory protein SphR Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
L7N689 1.29e-39 140 38 5 230 1 trcR Transcriptional regulatory protein TrcR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q7A0U4 1.62e-39 139 35 3 229 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MW2)
Q9L524 1.62e-39 139 35 3 229 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus
Q6G972 1.62e-39 139 35 3 229 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MSSA476)
Q6GGK6 1.62e-39 139 35 3 229 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain MRSA252)
Q7A5H6 1.62e-39 139 35 3 229 1 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain N315)
Q7A2R6 1.62e-39 139 35 3 229 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HFT0 1.62e-39 139 35 3 229 2 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain COL)
Q2FY79 1.62e-39 139 35 3 229 3 srrA Transcriptional regulatory protein SrrA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q99U73 2.41e-39 138 38 7 232 3 arlR Response regulator ArlR Staphylococcus aureus (strain N315)
Q49XM7 3.09e-39 138 37 5 232 3 arlR Response regulator ArlR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P35163 4.28e-39 138 35 4 232 1 resD Transcriptional regulatory protein ResD Bacillus subtilis (strain 168)
G3XCY6 7.08e-39 137 34 4 236 1 gltR Transcriptional regulatory protein GltR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4L6C6 8.64e-39 137 36 5 232 3 arlR Response regulator ArlR Staphylococcus haemolyticus (strain JCSC1435)
P54443 1.09e-38 137 35 4 231 3 yrkP Uncharacterized transcriptional regulatory protein YrkP Bacillus subtilis (strain 168)
O34903 2.04e-38 136 36 5 233 3 ykoG Uncharacterized transcriptional regulatory protein YkoG Bacillus subtilis (strain 168)
Q44929 5.15e-38 135 35 4 232 3 gtcR Response regulator GtcR Aneurinibacillus migulanus
P94504 1.57e-37 134 32 3 230 3 yvrH Transcriptional regulatory protein YvrH Bacillus subtilis (strain 168)
P32040 2.11e-37 134 37 3 235 3 SYNPCC7002_A0851 Probable transcriptional regulatory protein SYNPCC7002_A0851 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
P50350 4.85e-37 133 36 3 236 3 chvI Transcriptional regulatory protein ChvI Rhizobium meliloti (strain 1021)
Q31S42 1.57e-36 132 36 3 232 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
P23620 1.78e-36 131 34 4 229 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q55890 2.01e-36 131 36 3 238 1 rpaA DNA-binding dual master transcriptional regulator RpaA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q07783 2.3e-36 131 34 2 241 3 chvI Transcriptional regulatory protein ChvI Rhizobium radiobacter
Q9HUI2 3.18e-36 130 34 4 240 3 aruR Transcriptional regulatory protein AruR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q49ZT8 6.5e-36 129 33 3 229 3 hssR Heme response regulator HssR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9HV32 1.43e-35 128 38 4 228 1 pmrA Response regulator protein PmrA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O32192 1.68e-35 128 35 3 231 1 cssR Transcriptional regulatory protein CssR Bacillus subtilis (strain 168)
Q9KM23 3.09e-35 128 37 5 232 1 vxrB Transcriptional regulatory protein VxrB Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P44918 3.39e-35 128 34 3 227 3 arcA Aerobic respiration control protein ArcA homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P08368 4.78e-35 127 36 4 230 1 creB Transcriptional regulatory protein CreB Escherichia coli (strain K12)
Q2YZ24 5.91e-35 127 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain bovine RF122 / ET3-1)
A6QJK3 7.49e-35 127 34 4 229 1 hssR Heme response regulator HssR Staphylococcus aureus (strain Newman)
Q5HDJ4 7.49e-35 127 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain COL)
Q7A1J1 9.15e-35 126 34 4 230 3 saeR Response regulator SaeR Staphylococcus aureus (strain MW2)
Q6GBC4 9.15e-35 126 34 4 230 3 saeR Response regulator SaeR Staphylococcus aureus (strain MSSA476)
Q6GIT6 9.15e-35 126 34 4 230 3 saeR Response regulator SaeR Staphylococcus aureus (strain MRSA252)
Q7A6V3 9.15e-35 126 34 4 230 1 saeR Response regulator SaeR Staphylococcus aureus (strain N315)
Q99VR7 9.15e-35 126 34 4 230 3 saeR Response regulator SaeR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q840P8 9.15e-35 126 34 4 230 1 saeR Response regulator SaeR Staphylococcus aureus (strain Newman)
Q5HHW4 9.15e-35 126 34 4 230 1 saeR Response regulator SaeR Staphylococcus aureus (strain COL)
Q2YSM5 9.15e-35 126 34 4 230 3 saeR Response regulator SaeR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2G2 9.15e-35 126 34 4 230 1 saeR Response regulator SaeR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIT4 9.15e-35 126 34 4 230 3 saeR Response regulator SaeR Staphylococcus aureus (strain USA300)
P50351 9.55e-35 127 36 3 237 3 chvI Transcriptional regulatory protein ChvI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7A039 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MW2)
A8Z552 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300 / TCH1516)
Q6G6V9 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MSSA476)
Q7A3X1 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain N315)
Q99RR6 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IVE2 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH9)
Q2FVQ9 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FED5 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain USA300)
A6U488 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain JH1)
A7X5Y5 1.34e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q6GE73 1.35e-34 126 34 4 229 3 hssR Heme response regulator HssR Staphylococcus aureus (strain MRSA252)
P45189 2.18e-34 125 32 6 234 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8CQ17 2.23e-34 125 33 4 230 1 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR28 2.23e-34 125 33 4 230 3 saeR Response regulator SaeR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P9WGM1 2.32e-34 125 40 6 217 1 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM0 2.32e-34 125 40 6 217 3 prrA Transcriptional regulatory protein PrrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z7 2.32e-34 125 40 6 217 3 prrA Transcriptional regulatory protein PrrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q9I0I1 3.41e-34 125 36 4 228 1 carR Response regulator protein CarR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8DN02 5.49e-34 124 35 7 236 1 rr06 Response regulator RR06 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
A0A0H2ZNF6 5.49e-34 124 35 7 236 1 rr06 Response regulator RR06 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
P0DMK7 6.17e-34 124 35 3 229 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain K96243)
I1WSZ4 6.17e-34 124 35 3 229 3 irlR Transcriptional activator protein IrlR Burkholderia pseudomallei (strain 1026b)
P54884 8.6e-34 123 38 2 197 3 rgx3 Sensory transduction protein RegX3 Mycobacterium leprae (strain TN)
Q5HLN2 1.03e-33 124 33 4 229 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q50136 2.14e-33 123 40 6 217 3 prrA Transcriptional regulatory protein PrrA Mycobacterium leprae (strain TN)
P76340 3.71e-33 122 36 5 235 1 hprR Transcriptional regulatory protein HprR Escherichia coli (strain K12)
Q8CN92 4.19e-33 122 33 4 229 3 hssR Heme response regulator HssR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q70FH0 4.43e-33 122 36 4 233 3 pmrA Transcriptional regulatory protein PmrA Pectobacterium parmentieri
Q7D9K0 4.77e-33 123 36 4 228 3 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
O07776 4.77e-33 123 36 4 228 1 tcrA Transcriptional regulatory protein TcrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q52990 6.5e-33 122 36 5 237 3 phoB Phosphate regulon transcriptional regulatory protein PhoB Rhizobium meliloti (strain 1021)
P0A9Q4 7.06e-33 122 32 4 230 3 arcA Aerobic respiration control protein ArcA Shigella flexneri
P0A9Q1 7.06e-33 122 32 4 230 1 arcA Aerobic respiration control protein ArcA Escherichia coli (strain K12)
P0A9Q2 7.06e-33 122 32 4 230 3 arcA Aerobic respiration control protein ArcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A9Q3 7.06e-33 122 32 4 230 3 arcA Aerobic respiration control protein ArcA Escherichia coli O157:H7
P30843 7.89e-33 121 37 5 234 1 basR Transcriptional regulatory protein BasR Escherichia coli (strain K12)
Q9ZEP4 1.58e-32 121 33 3 231 1 cseB Transcriptional regulatory protein CseB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q44006 2.51e-32 120 34 3 229 2 czcR Transcriptional activator protein CzcR Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q9AE24 3.16e-32 120 32 4 232 3 rprY Transcriptional regulatory protein RprY Bacteroides fragilis (strain YCH46)
Q04803 3.71e-32 122 35 4 232 3 pfeR Transcriptional activator protein PfeR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6WZ81 5.09e-32 119 33 4 231 3 ctrA Cell cycle response regulator CtrA Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q93CB8 5.29e-32 119 33 2 228 3 mtrA DNA-binding response regulator MtrA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q8FZ93 5.31e-32 119 33 4 231 1 ctrA Cell cycle response regulator CtrA Brucella suis biovar 1 (strain 1330)
B0CI76 5.31e-32 119 33 4 231 3 ctrA Cell cycle response regulator CtrA Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VRW9 5.31e-32 119 33 4 231 1 ctrA Cell cycle response regulator CtrA Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q7CNV1 5.31e-32 119 33 4 231 1 ctrA Cell cycle response regulator CtrA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M708 5.31e-32 119 33 4 231 3 ctrA Cell cycle response regulator CtrA Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q9ZHS1 5.31e-32 119 33 4 231 1 ctrA Cell cycle response regulator CtrA Brucella abortus biovar 1 (strain 9-941)
Q2YQA4 5.31e-32 119 33 4 231 1 ctrA Cell cycle response regulator CtrA Brucella abortus (strain 2308)
B2S753 5.31e-32 119 33 4 231 3 ctrA Cell cycle response regulator CtrA Brucella abortus (strain S19)
P9WGM7 6.34e-32 119 33 2 228 1 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM6 6.34e-32 119 33 2 228 3 mtrA DNA-binding response regulator MtrA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A5Z5 6.34e-32 119 33 2 228 3 mtrA DNA-binding response regulator MtrA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q82EB1 8.39e-32 119 34 3 232 3 cseB Transcriptional regulatory protein CseB Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
A0QTK2 1.1e-31 119 33 2 228 1 mtrA DNA-binding response regulator MtrA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q9CCJ2 1.13e-31 118 38 3 228 3 mtrA DNA-binding response regulator MtrA Mycobacterium leprae (strain TN)
Q5HPC3 1.15e-31 118 34 4 236 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q8CP82 2.16e-31 117 34 4 236 3 arlR Response regulator ArlR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q02540 3.16e-31 117 36 5 230 1 copR Transcriptional activator protein CopR Pseudomonas syringae pv. tomato
Q01473 6.02e-31 123 35 3 234 3 rcaC Protein RcaC Microchaete diplosiphon
Q01473 1.79e-10 63 34 3 125 3 rcaC Protein RcaC Microchaete diplosiphon
Q04942 9.52e-31 116 37 4 229 1 afsQ1 Transcriptional regulatory protein AfsQ1 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P42421 9.86e-31 116 31 3 229 3 yxdJ Transcriptional regulatory protein YxdJ Bacillus subtilis (strain 168)
Q47456 2.22e-30 115 34 6 233 3 pcoR Transcriptional regulatory protein PcoR Escherichia coli
P36556 2.57e-30 115 36 5 235 1 basR Transcriptional regulatory protein BasR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P52076 3.28e-30 114 35 5 230 2 qseB Transcriptional regulatory protein QseB Escherichia coli (strain K12)
P52108 3.34e-30 115 33 2 234 1 rstA Transcriptional regulatory protein RstA Escherichia coli (strain K12)
Q4L8L9 4.59e-30 114 31 3 233 3 hssR Heme response regulator HssR Staphylococcus haemolyticus (strain JCSC1435)
Q47744 2.12e-29 112 33 3 227 3 vanRB Regulatory protein VanRB Enterococcus faecalis (strain ATCC 700802 / V583)
Q8XBS3 3.04e-29 112 34 5 230 2 qseB Transcriptional regulatory protein QseB Escherichia coli O157:H7
Q2FWH6 5.07e-29 112 31 4 233 1 kdpE Transcriptional regulatory protein KdpE Staphylococcus aureus (strain NCTC 8325 / PS 47)
P0A4H8 5.6e-29 111 34 5 232 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4H7 5.6e-29 111 34 5 232 3 ciaR Transcriptional regulatory protein CiaR Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0A4I0 8.84e-29 111 32 3 210 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P0A4H9 8.84e-29 111 32 3 210 3 dltR Transcriptional regulatory protein DltR Streptococcus agalactiae serotype III (strain NEM316)
B8H358 1.12e-28 110 31 3 230 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain NA1000 / CB15N)
P0CAW8 1.12e-28 110 31 3 230 3 ctrA Cell cycle transcriptional regulator CtrA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P66795 1.15e-28 110 34 4 233 3 qseB Transcriptional regulatory protein QseB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66796 1.15e-28 110 34 4 233 3 qseB Transcriptional regulatory protein QseB Salmonella typhi
P0ACZ8 2.47e-28 110 35 6 231 1 cusR Transcriptional regulatory protein CusR Escherichia coli (strain K12)
P0ACZ9 2.47e-28 110 35 6 231 3 cusR Transcriptional regulatory protein CusR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD00 2.47e-28 110 35 6 231 3 cusR Transcriptional regulatory protein CusR Escherichia coli O157:H7
P0CL17 4.17e-28 109 39 9 234 2 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WA34 4.17e-28 109 39 9 234 3 tctD Transcriptional regulatory protein TctD Salmonella typhimurium (strain SL1344)
P9WGN1 7.04e-28 108 32 4 230 1 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGN0 7.04e-28 108 32 4 230 3 kdpE Transcriptional regulatory protein KdpE Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q07597 7.8e-28 108 31 4 227 3 nisR Nisin biosynthesis regulatory protein NisR Lactococcus lactis subsp. lactis
Q9I4F9 1.13e-27 108 34 4 230 1 phoP Two-component response regulator PhoP Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZHD3 1.5e-27 108 36 7 232 3 silR Probable transcriptional regulatory protein SilR Salmonella typhimurium
P0A4I2 3.8e-27 106 33 4 228 3 cutR Transcriptional regulatory protein CutR Streptomyces lividans
P0A4I1 3.8e-27 106 33 4 228 3 cutR Transcriptional regulatory protein CutR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P45337 4.27e-27 106 32 6 235 3 qseB Transcriptional regulatory protein QseB Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P38684 4.94e-27 106 30 4 233 1 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli (strain K12)
P21866 9.73e-27 105 31 2 229 1 kdpE KDP operon transcriptional regulatory protein KdpE Escherichia coli (strain K12)
P13359 1.35e-26 105 32 5 233 3 virG Regulatory protein VirG Rhizobium rhizogenes
P58357 2.6e-26 104 29 4 233 3 torR TorCAD operon transcriptional regulatory protein TorR Escherichia coli O157:H7
O06978 4.26e-26 104 30 3 229 3 yvcP Uncharacterized transcriptional regulatory protein YvcP Bacillus subtilis (strain 168)
Q55933 4.52e-26 104 34 6 236 1 rppA Response regulator RppA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P23836 4.74e-26 103 31 5 234 1 phoP Transcriptional regulatory protein PhoP Escherichia coli (strain K12)
Q8CQ37 1.37e-25 102 28 4 229 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR81 1.37e-25 102 28 4 229 3 graR Response regulator protein GraR Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q83RR0 1.5e-25 102 31 5 234 3 phoP Virulence transcriptional regulatory protein PhoP Shigella flexneri
Q8CXZ9 1.5e-25 102 31 5 234 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8GP20 2.13e-25 102 33 5 231 1 rssB Swarming motility regulation protein RssB Serratia marcescens
Q932F1 2.92e-25 102 29 3 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8X738 3.8e-25 101 31 5 234 3 phoP Transcriptional regulatory protein PhoP Escherichia coli O157:H7
Q1XDE4 4.64e-25 101 38 6 184 3 ycf29 Probable transcriptional regulator ycf29 Neopyropia yezoensis
O24973 6.06e-25 101 31 3 229 1 arsR Transcriptional regulatory protein ArsR Helicobacter pylori (strain ATCC 700392 / 26695)
A8Z181 7.64e-25 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300 / TCH1516)
A6QEW8 7.64e-25 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain Newman)
Q5HI09 7.64e-25 100 28 3 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain COL)
Q2G0E0 7.64e-25 100 28 3 228 1 graR Response regulator protein GraR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIY0 7.64e-25 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain USA300)
Q8Z7H2 9.13e-25 100 31 4 232 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhi
Q7A1L2 1e-24 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain MW2)
Q6GBH1 1e-24 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain MSSA476)
Q99VW2 1e-24 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain N315)
A5IQL2 1e-24 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH9)
A6TZD6 1e-24 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain JH1)
A7WZC3 1e-24 100 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain Mu3 / ATCC 700698)
O69730 1.21e-24 100 32 4 232 1 tcrX Probable transcriptional regulatory protein TcrX Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0DM78 1.38e-24 100 31 4 232 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
F5ZP95 1.38e-24 100 31 4 232 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain ATCC 68169 / UK-1)
E1WFA1 1.38e-24 100 31 4 232 2 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain SL1344)
D0ZV90 1.38e-24 100 31 4 232 1 phoP Virulence transcriptional regulatory protein PhoP Salmonella typhimurium (strain 14028s / SGSC 2262)
Q5PMJ1 1.38e-24 100 31 4 232 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q9K621 1.39e-24 100 28 5 233 3 bceR Sensory transduction protein BceR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P33112 2e-24 99 32 5 229 3 spaR Transcriptional regulatory protein SpaR Bacillus subtilis
Q6GJ11 2.29e-24 99 28 4 229 3 graR Response regulator protein GraR Staphylococcus aureus (strain MRSA252)
Q2YSS2 2.62e-24 99 28 3 228 3 graR Response regulator protein GraR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q4L481 6.09e-24 98 28 5 229 3 graR Response regulator protein GraR Staphylococcus haemolyticus (strain JCSC1435)
Q57QC3 7.59e-24 98 30 4 232 3 phoP Virulence transcriptional regulatory protein PhoP Salmonella choleraesuis (strain SC-B67)
Q49VK3 2.77e-23 96 28 4 228 3 graR Response regulator protein GraR Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P62722 3.09e-23 97 33 6 234 3 virG Regulatory protein VirG Agrobacterium tumefaciens (strain 15955)
P07545 5.39e-23 96 32 4 232 3 virG Regulatory protein VirG Agrobacterium fabrum (strain C58 / ATCC 33970)
Q44444 1.23e-22 95 33 6 234 3 virG Regulatory protein VirG Rhizobium radiobacter
O34951 8.59e-19 85 26 4 230 3 bceR Sensory transduction protein BceR Bacillus subtilis (strain 168)
O31432 3.84e-18 83 27 8 227 3 ybdJ Uncharacterized transcriptional regulatory protein YbdJ Bacillus subtilis (strain 168)
P48359 2.01e-17 80 34 3 162 3 ycf29 Probable transcriptional regulator ycf29 Cyanophora paradoxa
P46384 1.85e-16 76 35 2 115 1 pilG Protein PilG Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P55701 6.01e-16 77 29 7 231 4 NGR_a00800 Probable transcriptional regulatory protein y4xI Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O25918 1e-15 76 29 7 229 3 crdR Transcriptional regulatory protein CrdR Helicobacter pylori (strain ATCC 700392 / 26695)
P72781 1.39e-15 76 37 5 136 1 rre1 Response regulator Rre1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P52931 1.93e-15 75 36 5 141 3 spo0A Stage 0 sporulation protein A (Fragment) Niallia circulans
B8GZM2 4.85e-15 77 36 2 133 1 pleD Response regulator PleD Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A5I5 4.85e-15 77 36 2 133 1 pleD Response regulator PleD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
T2KMF4 1.04e-14 76 37 3 116 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)
Q06065 1.04e-14 75 40 2 109 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P52929 1.05e-14 73 38 4 119 3 spo0A Stage 0 sporulation protein A (Fragment) Brevibacillus parabrevis
Q1IRH0 1.36e-14 75 31 10 211 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Koribacter versatilis (strain Ellin345)
P51343 3.88e-14 72 34 5 169 3 ycf29 Probable transcriptional regulator ycf29 Porphyra purpurea
P43501 4.36e-14 69 34 2 119 3 pilH Protein PilH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P03029 8.21e-14 73 39 6 135 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
P06534 8.65e-14 72 39 4 120 1 spo0A Stage 0 sporulation protein A Bacillus subtilis (strain 168)
P52932 1.37e-13 70 39 4 120 3 spo0A Stage 0 sporulation protein A (Fragment) Priestia megaterium
P52934 1.75e-13 71 37 4 124 1 spo0A Stage 0 sporulation protein A Geobacillus stearothermophilus
P14375 1.77e-13 72 35 2 135 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q8X613 1.88e-13 72 35 2 135 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
Q54SP4 2.51e-13 72 34 3 134 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
Q54SP4 6.41e-06 50 32 3 129 2 dhkD Hybrid signal transduction histidine kinase D Dictyostelium discoideum
P0A4I4 2.68e-13 70 36 4 125 3 spo0A Stage 0 sporulation protein A Bacillus thuringiensis
P0A4I3 2.68e-13 70 36 4 125 3 spo0A Stage 0 sporulation protein A Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
P52928 2.74e-13 70 36 4 127 3 spo0A Stage 0 sporulation protein A Bacillus anthracis
P41789 2.89e-13 71 38 6 134 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AFB8 3.69e-13 71 38 6 134 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 3.69e-13 71 38 6 134 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P24072 9.48e-13 66 38 4 112 1 cheY Chemotaxis protein CheY Bacillus subtilis (strain 168)
Q8Z333 1.52e-12 69 40 2 102 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
Q9APD9 1.86e-12 69 43 2 102 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P25852 1.87e-12 69 40 2 102 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P96686 3.9e-12 66 34 2 119 3 ydfI Transcriptional regulatory protein YdfI Bacillus subtilis (strain 168)
P40138 6.6e-12 67 32 3 146 1 cyaB Adenylate cyclase 2 Stigmatella aurantiaca
Q54YZ9 7.77e-12 68 34 3 142 3 dhkJ Hybrid signal transduction histidine kinase J Dictyostelium discoideum
P23221 8.63e-12 65 33 2 124 3 fixJ Transcriptional regulatory protein FixJ Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P51586 9.62e-12 63 38 2 109 3 None Uncharacterized 14.6 kDa protein in sodA1 3'region Leptolyngbya boryana
Q9KSB1 1.31e-11 67 36 3 117 1 VC_1348 Probable cyclic di-GMP phosphodiesterase VC_1348 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q86AT9 1.7e-11 67 36 3 116 3 dhkI-1 Hybrid signal transduction histidine kinase I Dictyostelium discoideum
P58253 2.61e-11 65 35 5 130 3 spo0A Stage 0 sporulation protein A homolog Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P52936 2.85e-11 65 34 5 138 3 spo0A Stage 0 sporulation protein A homolog Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
P52941 3.02e-11 64 35 4 116 3 spo0A Stage 0 sporulation protein A homolog Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
P0AEV3 3.09e-11 65 39 3 112 3 rssB Regulator of RpoS Shigella flexneri
P0AEV1 3.09e-11 65 39 3 112 1 rssB Regulator of RpoS Escherichia coli (strain K12)
P0AEV2 3.09e-11 65 39 3 112 3 rssB Regulator of RpoS Escherichia coli O157:H7
P26487 3.44e-11 63 34 4 133 3 fixJ Transcriptional regulatory protein FixJ Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q9WY30 3.49e-11 65 32 2 114 1 TM_0186 Cyclic di-GMP phosphodiesterase TM_0186 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
O05251 5.18e-11 63 45 6 107 3 malR Transcriptional regulatory protein MalR Bacillus subtilis (strain 168)
P28787 6.53e-11 64 34 6 150 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
Q1RJS1 8.86e-11 64 28 6 160 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P96602 1.5e-10 62 31 5 132 3 dctR Probable C4-dicarboxylate response regulator DctR Bacillus subtilis (strain 168)
P45709 1.96e-10 60 37 5 119 3 ccdB Protein CcdB Bacillus subtilis (strain 168)
Q8L9Y3 2e-10 63 32 3 141 1 ARR14 Two-component response regulator ARR14 Arabidopsis thaliana
Q7MBQ5 2.54e-10 62 40 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain YJ016)
Q8D4X6 2.55e-10 62 40 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Vibrio vulnificus (strain CMCP6)
P52940 2.73e-10 62 33 4 130 3 spo0A Stage 0 sporulation protein A homolog Clostridium pasteurianum
P71403 3.06e-10 59 30 3 119 1 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain ATCC 700392 / 26695)
Q9ZM64 4.38e-10 58 30 3 119 3 cheY1 Chemotaxis protein CheY1 Helicobacter pylori (strain J99 / ATCC 700824)
P52938 4.38e-10 61 36 4 119 3 spo0A Stage 0 sporulation protein A homolog Clostridioides difficile
P39486 5.47e-10 60 36 7 112 3 dctR Probable C4-dicarboxylate response regulator DctR Priestia megaterium
Q10WZ6 5.86e-10 61 39 6 108 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Trichodesmium erythraeum (strain IMS101)
Q2RRX2 6.7e-10 61 28 9 212 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
O58192 7.9e-10 61 33 6 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9I4N3 9e-10 61 38 3 113 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4UL27 9.19e-10 61 33 3 109 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92HC2 9.8e-10 61 33 3 109 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
D4GXP4 1.06e-09 61 39 2 101 3 HVO_1357 Putative transcriptional regulator HVO_1357 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q2KCH7 1.11e-09 58 35 5 121 3 cheY Probable chemotaxis protein CheY Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q9ZCY9 1.2e-09 61 32 3 109 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q5A4X5 1.2e-09 61 34 2 108 3 SKN7 Transcription factor SKN7 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q51455 1.24e-09 57 34 3 122 3 cheY Chemotaxis protein CheY Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8KIY1 1.38e-09 61 30 3 117 1 tmoS Sensor histidine kinase TmoS Pseudomonas mendocina
B0R4K1 1.65e-09 57 31 4 117 1 cheY Chemotaxis protein CheY Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q9UYF3 1.79e-09 60 32 6 125 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Pyrococcus abyssi (strain GE5 / Orsay)
A1W0A5 1.83e-09 57 31 4 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
P0C635 1.83e-09 57 31 4 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FMH1 1.83e-09 57 31 4 119 3 cheY Chemotaxis protein CheY homolog Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q5JF95 2.01e-09 60 35 6 116 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
P39928 3.76e-09 60 31 3 108 1 SLN1 Osmosensing histidine protein kinase SLN1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P52942 4.22e-09 56 35 4 114 3 spo0F Sporulation initiation phosphotransferase F Bacillus thuringiensis subsp. kurstaki
Q88RJ6 4.29e-09 59 34 3 110 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2WAJ8 4.48e-09 59 35 7 129 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q87GU5 4.68e-09 59 37 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P09432 5.04e-09 59 32 3 114 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q68WH4 5.17e-09 59 30 3 109 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q5SML4 5.85e-09 59 26 2 136 2 HK2 Probable histidine kinase 2 Oryza sativa subsp. japonica
A2YA15 5.85e-09 59 26 2 136 3 HK2 Probable histidine kinase 2 Oryza sativa subsp. indica
Q9AAK0 6.21e-09 58 39 5 109 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
P06628 6.6e-09 55 38 4 108 1 spo0F Sporulation initiation phosphotransferase F Bacillus subtilis (strain 168)
A2YQ93 8.15e-09 58 33 2 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. indica
Q0D3B6 8.22e-09 58 33 2 121 2 PRR37 Two-component response regulator-like PRR37 Oryza sativa subsp. japonica
A2X1N2 8.38e-09 58 31 1 129 3 RR24 Two-component response regulator ORR24 Oryza sativa subsp. indica
Q6H805 8.54e-09 58 31 1 129 2 RR24 Two-component response regulator ORR24 Oryza sativa subsp. japonica
Q88AQ2 8.8e-09 58 33 3 110 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P40759 9.27e-09 58 28 2 119 3 glnL Transcriptional regulatory protein GlnL Bacillus subtilis (strain 168)
P96126 1.1e-08 55 27 2 119 3 cheY Chemotaxis protein CheY Treponema pallidum (strain Nichols)
Q5A599 1.25e-08 58 29 2 129 1 NIK1 Histidine protein kinase NIK1 Candida albicans (strain SC5314 / ATCC MYA-2876)
Q9HU19 1.38e-08 57 34 2 116 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q30RX5 1.53e-08 57 28 5 146 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
E0X9C7 1.76e-08 57 31 3 113 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain DOT-T1E)
Q9HWA4 2.16e-08 56 31 4 113 1 pprB Two-component response regulator PprB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q04849 2.21e-08 57 33 4 118 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P9WGM3 2.42e-08 55 32 4 119 1 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGM2 2.42e-08 55 32 4 119 3 pdtaR Transcriptional regulatory protein PdtaR Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q9FXD6 2.57e-08 57 30 1 118 1 ARR11 Two-component response regulator ARR11 Arabidopsis thaliana
Q05943 2.58e-08 56 35 3 140 3 glnR Transcriptional regulatory protein GlnR Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q9KM66 2.62e-08 57 31 3 116 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P42012 2.66e-08 56 33 3 115 3 spo0A Stage 0 sporulation protein A Lysinibacillus sphaericus
A7N6S2 2.85e-08 57 32 6 124 1 cqsS CAI-1 autoinducer sensor kinase/phosphatase CqsS Vibrio campbellii (strain ATCC BAA-1116)
P23747 3.16e-08 57 29 6 175 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q7MD16 3.21e-08 57 32 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain YJ016)
Q8D5Z6 3.39e-08 57 32 2 108 3 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio vulnificus (strain CMCP6)
P10576 4.89e-08 56 26 4 152 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
Q3LWR6 5.65e-08 55 28 3 128 3 todT Response regulator protein TodT Pseudomonas putida
I7CA98 5.65e-08 55 28 3 128 1 todT Response regulator protein TodT Pseudomonas putida (strain DOT-T1E)
A5W4E2 5.65e-08 55 28 3 128 1 todT Response regulator protein TodT Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q56312 5.71e-08 53 28 3 110 1 cheY Chemotaxis protein CheY Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
P10577 6.08e-08 56 27 2 135 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P62646 6.44e-08 55 36 5 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P45671 7.04e-08 55 32 3 110 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
A5W4E3 7.23e-08 56 30 3 113 1 todS Sensor histidine kinase TodS Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q55169 7.34e-08 53 31 4 132 1 rcp1 Response regulator Rcp1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P0A2D5 8.21e-08 52 31 3 120 1 cheY Chemotaxis protein CheY Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D6 8.21e-08 52 31 3 120 3 cheY Chemotaxis protein CheY Salmonella typhi
P0AFU5 8.57e-08 55 35 2 117 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 8.57e-08 55 35 2 117 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
P38889 9.11e-08 55 30 3 146 1 SKN7 Transcription factor SKN7 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P72253 9.51e-08 55 34 5 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase of group 2 operon Rhodospirillum centenum (strain ATCC 51521 / SW)
Q5V0B3 1.01e-07 55 27 4 145 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q04848 1.03e-07 55 26 3 138 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P15940 1.07e-07 54 28 2 132 3 nodW Nodulation protein W Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q4UU85 1.1e-07 55 31 4 144 1 rpfG Cyclic di-GMP phosphodiesterase response regulator RpfG Xanthomonas campestris pv. campestris (strain 8004)
Q9FAD7 1.21e-07 52 31 3 120 3 cheY Chemotaxis protein CheY Enterobacter cloacae
Q8VL08 1.27e-07 55 36 5 112 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Azospirillum brasilense
Q31HL9 1.51e-07 54 29 6 147 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q6GK51 1.59e-07 53 31 5 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MRSA252)
Q8NYH3 1.7e-07 53 31 5 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MW2)
Q6GCL1 1.7e-07 53 31 5 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain MSSA476)
P0DMI2 1.77e-07 54 33 4 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R4K0 1.77e-07 54 33 4 105 1 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q67P67 1.79e-07 54 35 3 104 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P0AE69 2e-07 52 31 3 120 3 cheY Chemotaxis protein CheY Shigella flexneri
P0AE67 2e-07 52 31 3 120 1 cheY Chemotaxis protein CheY Escherichia coli (strain K12)
P0AE68 2e-07 52 31 3 120 3 cheY Chemotaxis protein CheY Escherichia coli O157:H7
Q9KQD5 2.15e-07 52 33 3 120 1 VC_2065 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A0A0H3AMJ9 2.15e-07 52 33 3 120 1 cheY-3 Chemotaxis protein CheY-3 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0A4H5 2.24e-07 51 34 4 117 3 cheY Chemotaxis protein CheY Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P0A4H6 2.24e-07 51 34 4 117 3 cheY Chemotaxis protein CheY Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P62598 2.42e-07 54 33 3 118 2 ARR12 Two-component response regulator ARR12 Arabidopsis thaliana
Q65JK6 2.58e-07 53 36 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2YV67 2.66e-07 53 31 5 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q9F8D7 2.71e-07 54 30 2 113 3 gacS Sensor histidine kinase GacS Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CFBP 6595 / CHA0)
O49397 2.74e-07 54 33 3 118 1 ARR10 Two-component response regulator ARR10 Arabidopsis thaliana
Q940D0 2.79e-07 54 31 2 124 1 ARR1 Two-component response regulator ARR1 Arabidopsis thaliana
P31802 2.84e-07 53 28 7 233 3 narP Nitrate/nitrite response regulator protein NarP Escherichia coli (strain K12)
Q8FGP6 3.11e-07 51 31 3 120 3 cheY Chemotaxis protein CheY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P62637 3.5e-07 53 34 5 123 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q9LYP5 3.92e-07 53 25 4 135 2 ARR21 Putative two-component response regulator ARR21 Arabidopsis thaliana
Q8H7S7 4.2e-07 53 30 4 133 2 RR21 Two-component response regulator ORR21 Oryza sativa subsp. japonica
A2XE31 4.24e-07 53 30 4 133 3 RR21 Two-component response regulator ORR21 Oryza sativa subsp. indica
Q8D0P1 4.37e-07 50 30 3 120 3 cheY Chemotaxis protein CheY Yersinia pestis
P24086 4.65e-07 50 25 4 120 4 LA_2151 Uncharacterized protein LA_2151 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RH6 4.65e-07 50 25 4 120 3 LIC_11769 Uncharacterized protein LIC_11769 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
P18769 4.69e-07 53 34 2 102 1 frzE Gliding motility regulatory protein Myxococcus xanthus
Q05522 4.72e-07 53 34 4 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Bacillus subtilis (strain 168)
P62640 4.75e-07 53 31 3 104 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q9ZWJ9 4.77e-07 53 28 3 157 1 ARR2 Two-component response regulator ARR2 Arabidopsis thaliana
P60610 5.08e-07 52 30 5 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain N315)
P60609 5.08e-07 52 30 5 138 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HJB5 5.08e-07 52 30 5 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain COL)
P60611 5.08e-07 52 30 5 138 1 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FK09 5.08e-07 52 30 5 138 3 lytR Transcriptional regulatory protein LytR Staphylococcus aureus (strain USA300)
Q2ILG8 5.2e-07 53 30 8 184 3 cheB6 Protein-glutamate methylesterase/protein-glutamine glutaminase 6 Anaeromyxobacter dehalogenans (strain 2CP-C)
Q93P00 5.28e-07 50 30 3 120 3 cheY Chemotaxis protein CheY Yersinia enterocolitica
P10046 5.5e-07 53 32 4 113 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
Q2SFK0 5.75e-07 52 33 3 103 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Hahella chejuensis (strain KCTC 2396)
Q3SIG0 6.34e-07 52 37 5 107 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Thiobacillus denitrificans (strain ATCC 25259)
Q311M8 6.73e-07 52 31 6 132 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5SML5 7.26e-07 53 33 1 118 2 RR22 Two-component response regulator ORR22 Oryza sativa subsp. japonica
B8B3I4 7.26e-07 53 33 1 118 3 RR22 Two-component response regulator ORR22 Oryza sativa subsp. indica
P0AE41 7.48e-07 52 29 5 138 3 ypdB Transcriptional regulatory protein YpdB Shigella flexneri
P0AE39 7.48e-07 52 29 5 138 1 ypdB Transcriptional regulatory protein YpdB Escherichia coli (strain K12)
P0AE40 7.48e-07 52 29 5 138 3 ypdB Transcriptional regulatory protein YpdB Escherichia coli O157:H7
Q085K9 7.86e-07 52 30 5 131 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Shewanella frigidimarina (strain NCIMB 400)
P13632 9.08e-07 52 30 2 111 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
Q00934 9.2e-07 52 35 3 113 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9I6V9 9.32e-07 52 40 4 104 1 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8XQ83 9.32e-07 52 36 5 110 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q6K8X6 9.72e-07 52 32 1 118 2 RR23 Two-component response regulator ORR23 Oryza sativa subsp. japonica
Q87MX7 1.07e-06 52 25 3 131 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B8AEH1 1.07e-06 52 32 1 118 3 RR23 Two-component response regulator ORR23 Oryza sativa subsp. indica
Q4L8V4 1.11e-06 51 37 5 106 3 lytR Sensory transduction protein LytR Staphylococcus haemolyticus (strain JCSC1435)
P52939 1.22e-06 51 34 5 117 3 spo0A Stage 0 sporulation protein A homolog Clostridium innocuum
Q1BRL2 1.22e-06 52 34 3 105 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia orbicola (strain AU 1054)
P0C5S5 1.24e-06 52 25 3 131 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 1.24e-06 52 25 3 131 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
P48027 1.24e-06 52 30 2 113 3 gacS Sensor protein GacS Pseudomonas syringae pv. syringae
A1SMR4 1.31e-06 52 29 8 155 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q3ADA6 1.33e-06 52 34 4 105 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q1MP86 1.45e-06 51 30 6 136 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Lawsonia intracellularis (strain PHE/MN1-00)
Q8KR08 1.6e-06 50 28 3 118 1 tmoT Response regulator protein TmoT Pseudomonas mendocina
P54302 1.71e-06 52 33 2 108 1 luxQ Autoinducer 2 sensor kinase/phosphatase LuxQ Vibrio harveyi
Q6AJV3 1.82e-06 51 39 5 105 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
P62645 1.83e-06 51 37 4 108 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7N5T1 1.85e-06 51 38 6 111 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9RC52 1.87e-06 50 29 5 134 3 citT Transcriptional regulatory protein CitT Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q9LZJ8 1.94e-06 51 27 2 119 2 ARR20 Putative two-component response regulator ARR20 Arabidopsis thaliana
Q39KQ1 2.05e-06 51 31 6 147 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q10N34 2.07e-06 51 31 2 121 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. japonica
A2XFB7 2.12e-06 51 31 2 121 2 PRR73 Two-component response regulator-like PRR73 Oryza sativa subsp. indica
Q5QZQ3 2.26e-06 51 34 7 120 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q7NSI8 2.29e-06 51 32 6 138 3 cheB3 Protein-glutamate methylesterase/protein-glutamine glutaminase 3 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P54662 2.48e-06 50 23 6 214 3 degU Transcriptional regulatory protein DegU Brevibacillus brevis
Q2LR65 2.49e-06 50 25 7 200 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Syntrophus aciditrophicus (strain SB)
O85128 2.52e-06 50 26 6 167 3 cheB Protein-glutamate methylesterase/protein-glutamine glutaminase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2STS8 2.89e-06 50 38 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
O25408 2.94e-06 50 29 3 117 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
Q63PS2 2.95e-06 50 38 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain K96243)
O25153 2.99e-06 51 27 2 115 1 cheAY Sensor histidine kinase CheAY Helicobacter pylori (strain ATCC 700392 / 26695)
Q3JY65 3.05e-06 50 38 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia pseudomallei (strain 1710b)
Q62G12 3.05e-06 50 38 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Burkholderia mallei (strain ATCC 23344)
Q39T95 3.09e-06 50 30 4 106 3 cheB2 Protein-glutamate methylesterase/protein-glutamine glutaminase 2 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q8FW53 3.15e-06 48 28 3 120 3 divK Polar-differentiation response regulator DivK Brucella suis biovar 1 (strain 1330)
A9WYT1 3.15e-06 48 28 3 120 3 divK Polar-differentiation response regulator DivK Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VUU3 3.15e-06 48 28 3 120 3 divK Polar-differentiation response regulator DivK Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YC73 3.15e-06 48 28 3 120 3 divK Polar-differentiation response regulator DivK Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9MBQ2 3.15e-06 48 28 3 120 3 divK Polar-differentiation response regulator DivK Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q7BBW0 3.15e-06 48 28 3 120 1 divK Polar-differentiation response regulator DivK Brucella abortus biovar 1 (strain 9-941)
Q2YKN1 3.15e-06 48 28 3 120 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain 2308)
B2SB45 3.15e-06 48 28 3 120 3 divK Polar-differentiation response regulator DivK Brucella abortus (strain S19)
P0AED6 3.23e-06 50 28 6 160 3 uvrY Response regulator UvrY Shigella flexneri
P0AED5 3.23e-06 50 28 6 160 1 uvrY Response regulator UvrY Escherichia coli (strain K12)
Q23917 3.24e-06 51 27 4 131 1 regA 3',5'-cyclic-nucleotide phosphodiesterase regA Dictyostelium discoideum
Q9K998 3.44e-06 50 29 7 148 3 dctR Probable C4-dicarboxylate response regulator DctR Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q221I1 3.49e-06 50 38 5 107 3 cheB1 Protein-glutamate methylesterase/protein-glutamine glutaminase 1 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
P39048 3.62e-06 50 31 2 112 2 patA Protein PatA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
P66797 3.69e-06 49 28 6 160 3 uvrY Response regulator UvrY Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_13975
Feature type CDS
Gene cpxR
Product envelope stress response regulator transcription factor CpxR
Location 4557 - 5261 (strand: -1)
Length 705 (nucleotides) / 234 (amino acids)

Contig

Accession ZDB_224
Length 134704 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1772
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00072 Response regulator receiver domain
PF00486 Transcriptional regulatory protein, C terminal

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0745 Signal transduction mechanisms (T)
Transcription (K)
TK DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07662 two-component system, OmpR family, response regulator CpxR Cationic antimicrobial peptide (CAMP) resistance
Two-component system
-

Protein Sequence

MNKILLVDDDRELTSLLKELLDMEGFNVVIAHDGEQALTLLDDSIDLLLLDIMMPRKNGIETLKELRQNYQTPVIMLTARGSDLDRVLGLELGADDYLPKPFNDRELVARIRAILRRSNWSEQQQQSDSSSNSSVVMVDKLQLNPGRQEASFGDEVLDLTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERTDGLPWFKTLRGRGYLMVSAT

Flanking regions ( +/- flanking 50bp)

ATGGAATAGAAACGTTTGTTGTCGTATTTTGCACGTGGAGGACGTGAATAATGAATAAAATACTGCTTGTTGATGATGACCGCGAATTAACCTCGCTGTTAAAAGAATTACTCGATATGGAAGGGTTCAACGTTGTCATTGCACATGACGGCGAGCAGGCACTGACCCTCCTTGACGATTCCATAGACTTGTTATTGCTCGACATCATGATGCCGCGCAAAAACGGGATTGAAACCCTGAAAGAACTGCGCCAGAACTACCAGACTCCGGTGATTATGCTGACCGCACGCGGCAGTGACCTTGACCGTGTTCTGGGGCTCGAACTGGGTGCGGATGACTATCTGCCGAAGCCGTTTAACGATCGCGAGCTGGTGGCACGTATACGCGCGATTCTGCGCCGCTCCAACTGGAGTGAGCAACAGCAGCAGAGCGACAGCAGCAGTAACTCTTCCGTGGTGATGGTGGATAAACTCCAGCTCAACCCGGGCCGTCAGGAAGCCAGCTTCGGCGACGAAGTACTGGATCTGACCGGAACCGAGTTCACGCTGCTTTACCTGCTGGCACAACACCTCGGCCAAGTGGTCAGCCGTGAACACTTAAGCCAGGAAGTGCTGGGCAAACGCCTGACGCCGTTTGACCGCGCCATTGATATGCACATTTCCAACCTGCGCCGCAAATTACCGGAGCGCACAGACGGCCTGCCGTGGTTTAAAACGTTACGCGGCCGTGGTTACTTAATGGTATCTGCAACATGATAAGCAGCCTGACGGCGCGGATTTTCGCCATCTTCTGGTTTACCCTGGCG