Homologs in group_2896

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12350 FBDBKF_12350 100.0 Morganella morganii S1 - CTP--phosphocholine cytidylyltransferase
NLDBIP_15050 NLDBIP_15050 100.0 Morganella morganii S4 - CTP--phosphocholine cytidylyltransferase
LHKJJB_15560 LHKJJB_15560 100.0 Morganella morganii S3 - CTP--phosphocholine cytidylyltransferase
HKOGLL_14680 HKOGLL_14680 100.0 Morganella morganii S5 - CTP--phosphocholine cytidylyltransferase
F4V73_RS17180 F4V73_RS17180 77.2 Morganella psychrotolerans - NTP transferase domain-containing protein

Distribution of the homologs in the orthogroup group_2896

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2896

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P14183 1.77e-80 243 54 1 224 3 licC Choline-phosphate cytidylyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8DPI6 3.52e-43 148 36 2 223 1 licC Choline-phosphate cytidylyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B9CM12 4.1e-27 107 30 6 222 1 pntC 2-aminoethylphosphonate cytidylyltransferase Lancefieldella rimae (strain ATCC 49626 / DSM 7090 / CCUG 31168 / NBRC 15546 / VPI D140H-11A)
Q73MU2 1.39e-12 69 38 2 105 1 pntC Bifunctional 2-aminoethylphosphonate cytidylyltransferase/aminotransferase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
Q88QT2 3.55e-06 49 31 3 108 1 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q0P8J8 3.75e-06 50 30 2 120 1 Cj1416c CTP:phosphoglutamine cytidylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q9RW61 6.03e-06 50 30 3 111 3 glmU Bifunctional protein GlmU Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A5PJI7 6.15e-06 50 24 7 209 2 EIF2B3 Translation initiation factor eIF2B subunit gamma Bos taurus
Q0ZQ41 8.63e-06 49 35 4 111 1 frbH CMP-5'-(3-aminopropyl)phosphonate synthase Streptomyces rubellomurinus (strain ATCC 31215)
Q6GDU6 8.9e-06 48 38 3 95 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MRSA252)
Q49VP4 1.17e-05 48 37 3 95 3 gtaB2 UTP--glucose-1-phosphate uridylyltransferase 2 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q8NUU9 1.25e-05 48 37 3 95 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MW2)
Q6G6H5 1.25e-05 48 37 3 95 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain MSSA476)
Q7A3J9 1.25e-05 48 37 3 95 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain N315)
Q99RD4 1.25e-05 48 37 3 95 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HD54 1.25e-05 48 37 3 95 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain COL)
Q2G1T6 1.25e-05 48 37 3 95 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FE05 1.25e-05 48 37 3 95 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain USA300)
Q975F9 1.27e-05 48 29 5 156 1 STK_04520 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q2YW63 1.29e-05 48 37 3 95 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
O31822 1.35e-05 48 28 0 114 1 yngB UTP--glucose-1-phosphate uridylyltransferase YngB Bacillus subtilis (strain 168)
Q4L8Y7 1.56e-05 48 39 2 87 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus haemolyticus (strain JCSC1435)
Q05852 1.59e-05 48 45 0 60 1 gtaB UTP--glucose-1-phosphate uridylyltransferase Bacillus subtilis (strain 168)
Q8CR67 1.6e-05 48 47 0 53 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLD1 1.6e-05 48 47 0 53 3 gtaB UTP--glucose-1-phosphate uridylyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A3DIP9 2.13e-05 48 33 3 104 3 glmU Bifunctional protein GlmU Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
D4GU70 3.23e-05 47 38 0 59 3 agl11 Low-salt glycan biosynthesis nucleotidyltransferase Agl11 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A5GDL4 3.94e-05 47 27 6 161 3 glmU Bifunctional protein GlmU Geotalea uraniireducens (strain Rf4)
P39629 4.77e-05 46 45 0 53 1 rmlA Glucose-1-phosphate thymidylyltransferase Bacillus subtilis (strain 168)
P0DG73 6.13e-05 46 43 0 60 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain SSI-1)
P67070 6.13e-05 46 43 0 60 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0DG72 6.13e-05 46 43 0 60 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P67068 6.13e-05 46 43 0 60 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M1
Q5XE04 6.13e-05 46 43 0 60 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q5X9A7 6.38e-05 46 41 0 60 3 hasC2 UTP--glucose-1-phosphate uridylyltransferase 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DG71 6.38e-05 46 41 0 60 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DG70 6.38e-05 46 41 0 60 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P0C0I8 6.87e-05 46 41 0 60 3 hasC UTP--glucose-1-phosphate uridylyltransferase Streptococcus pyogenes
Q8NKW9 6.87e-05 46 41 0 60 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P0C0I9 8.12e-05 46 41 0 60 3 hasC1 UTP--glucose-1-phosphate uridylyltransferase 1 Streptococcus pyogenes serotype M1
C0ZHD4 8.25e-05 46 27 3 110 3 glmU Bifunctional protein GlmU Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
O29976 9.42e-05 46 34 3 100 1 AF_0263 Bifunctional IPC transferase and DIPP synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q0P8J1 0.000103 45 33 1 65 1 hddC D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B1YGP5 0.000108 46 29 4 116 3 glmU Bifunctional protein GlmU Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
P70541 0.000116 46 25 8 209 2 Eif2b3 Translation initiation factor eIF2B subunit gamma Rattus norvegicus
D4GYH1 0.000133 45 25 2 112 1 aglF UTP--glucose-1-phosphate uridylyltransferase AglF Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q54800 0.000142 45 43 0 60 3 cap3C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae
P58313 0.000176 45 41 0 60 3 cap4C UTP--glucose-1-phosphate uridylyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q4A122 0.000183 45 36 2 87 3 gtaB1 UTP--glucose-1-phosphate uridylyltransferase 1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9JXY0 0.000414 43 44 0 61 3 murU N-acetylmuramate alpha-1-phosphate uridylyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9NR50 0.000588 43 24 8 209 1 EIF2B3 Translation initiation factor eIF2B subunit gamma Homo sapiens
A6UP85 0.000782 43 29 6 141 3 Mevan_0399 Bifunctional protein GlmU Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
P74285 0.001 43 37 0 61 1 cugP UTP--glucose-1-phosphate uridylyltransferase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_13955
Feature type CDS
Gene -
Product CTP--phosphocholine cytidylyltransferase
Location 192 - 878 (strand: -1)
Length 687 (nucleotides) / 228 (amino acids)

Contig

Accession ZDB_224
Length 134704 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2896
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF12804 MobA-like NTP transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4750 Cell wall/membrane/envelope biogenesis (M)
Lipid transport and metabolism (I)		 MI CTP:phosphocholine cytidylyltransferase LicC

Protein Sequence

MNAVILAAGLGSRFGDITKKTHKALLPIGGIPNIERTIQYLSEFGITEIVIVTGHLAHQFEYLQEKYGCILIHNEQYQEYNNIYSFLKIADYFNDTLVIDADVVLLKNIFIKSEHSLYYTVKRTTPEHEWIPVLGRNGYIERIDIKEPTAPSLLGISYWKSAESEKILAELPKFTDVTSLNNSKLYWDNIPMSIIHDLNMKTYEVSSDVAGEMDNIENYNSLVMLYNN

Flanking regions ( +/- flanking 50bp)

ATAGCCGGAGCGCTTATTACAAATCTGCAATCAAAGGAAGTTTTAGCAAAATGAATGCTGTGATCTTAGCTGCTGGTCTTGGTTCCCGGTTTGGTGATATAACAAAAAAAACACATAAGGCTCTTTTACCTATCGGTGGAATACCTAATATTGAAAGAACAATTCAATATCTGTCAGAATTCGGTATTACTGAAATAGTTATTGTCACCGGTCATCTCGCACATCAGTTTGAATATCTGCAAGAAAAATATGGCTGTATACTGATACATAATGAACAGTATCAAGAGTACAATAATATATATTCATTTTTGAAAATAGCCGATTATTTTAATGATACTCTGGTTATTGATGCTGATGTTGTACTGCTGAAAAATATCTTTATCAAAAGTGAACACAGCCTTTATTATACTGTAAAACGTACAACTCCTGAACATGAATGGATTCCTGTATTAGGCAGAAATGGATATATCGAACGAATAGATATCAAAGAACCAACAGCCCCCTCTTTATTAGGTATTTCTTACTGGAAATCAGCTGAATCAGAAAAAATTTTAGCTGAGCTACCAAAATTTACTGATGTAACGAGTCTAAATAATTCAAAGCTCTATTGGGATAATATCCCTATGTCTATAATTCATGACCTAAACATGAAAACTTATGAAGTTTCATCTGATGTTGCGGGTGAGATGGATAATATAGAAAATTATAATAGCCTTGTTATGTTATATAATAATTAATTAAAAACAAACCCATGAATAAAATAAAATTAATTCTTATAACAATAAGA