Homologs in group_1427

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08820 FBDBKF_08820 100.0 Morganella morganii S1 rraB ribonuclease E inhibitor RraB
NLDBIP_13045 NLDBIP_13045 100.0 Morganella morganii S4 rraB ribonuclease E inhibitor RraB
LHKJJB_13510 LHKJJB_13510 100.0 Morganella morganii S3 rraB ribonuclease E inhibitor RraB
HKOGLL_11520 HKOGLL_11520 100.0 Morganella morganii S5 rraB ribonuclease E inhibitor RraB
F4V73_RS10040 F4V73_RS10040 94.1 Morganella psychrotolerans rraB ribonuclease E inhibitor RraB
PMI_RS17235 PMI_RS17235 69.4 Proteus mirabilis HI4320 rraB ribonuclease E inhibitor RraB

Distribution of the homologs in the orthogroup group_1427

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1427

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
D4GIR2 1.66e-58 180 71 0 126 3 rraB Regulator of ribonuclease activity B Pantoea ananatis (strain LMG 20103)
P0AF92 8.13e-58 178 77 0 114 3 rraB Regulator of ribonuclease activity B Shigella flexneri
P0AF90 8.13e-58 178 77 0 114 1 rraB Regulator of ribonuclease activity B Escherichia coli (strain K12)
P0AF91 8.13e-58 178 77 0 114 3 rraB Regulator of ribonuclease activity B Escherichia coli O157:H7
D3VIS7 2.14e-55 172 74 0 114 3 rraB Regulator of ribonuclease activity B Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)
Q2NR38 4.11e-53 167 72 0 111 3 rraB Regulator of ribonuclease activity B Sodalis glossinidius (strain morsitans)
P0A1U6 8.59e-51 160 76 0 115 3 rraB Regulator of ribonuclease activity B Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1U7 8.59e-51 160 76 0 115 3 rraB Regulator of ribonuclease activity B Salmonella typhi
C9XUB3 8.96e-47 150 71 1 111 3 rraB Regulator of ribonuclease activity B Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
B4F2M5 9.05e-46 148 73 0 114 3 rraB Regulator of ribonuclease activity B Proteus mirabilis (strain HI4320)
A1SAD4 5.46e-45 146 62 0 113 3 rraB Regulator of ribonuclease activity B Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8FQV9 1.46e-40 135 55 0 118 3 rraB Regulator of ribonuclease activity B Shewanella sediminis (strain HAW-EB3)
A6VKX6 5.72e-39 131 59 1 118 3 rraB Regulator of ribonuclease activity B Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q12RV3 1.11e-38 130 58 0 109 3 rraB Regulator of ribonuclease activity B Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A0KNU5 4.66e-38 127 54 0 111 3 rraB Regulator of ribonuclease activity B Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
P44831 1.28e-36 125 56 0 114 1 rraB Regulator of ribonuclease activity B Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5F9Q2 1.34e-36 125 58 0 125 3 rraB Regulator of ribonuclease activity B Aliivibrio fischeri (strain MJ11)
A4SJC2 1.98e-35 121 52 0 110 3 rraB Regulator of ribonuclease activity B Aeromonas salmonicida (strain A449)
A1ST89 6.47e-34 117 52 0 115 3 rraB Regulator of ribonuclease activity B Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B4RWP8 2.33e-33 116 54 1 111 3 rraB Regulator of ribonuclease activity B Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q7VNY1 6.66e-31 110 53 0 111 3 rraB Regulator of ribonuclease activity B Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LUW5 1.04e-30 110 57 1 113 3 rraB Regulator of ribonuclease activity B Photobacterium profundum (strain SS9)
Q3IG75 4.19e-29 105 48 0 111 3 rraB Regulator of ribonuclease activity B Pseudoalteromonas translucida (strain TAC 125)
Q15X31 2.22e-26 98 45 0 107 3 rraB Regulator of ribonuclease activity B Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q487J9 1.79e-24 93 47 0 111 3 rraB Regulator of ribonuclease activity B Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5QY14 1.19e-18 79 39 1 111 3 rraB Regulator of ribonuclease activity B Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_12705
Feature type CDS
Gene rraB
Product ribonuclease E inhibitor RraB
Location 19476 - 19883 (strand: -1)
Length 408 (nucleotides) / 135 (amino acids)

Contig

Accession ZDB_222
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1427
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06877 Regulator of ribonuclease activity B

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3076 Translation, ribosomal structure and biogenesis (J) J Regulator of RNase E activity RraB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09893 regulator of ribonuclease activity B - -

Protein Sequence

MSELDAFLEEQREETRAIIAELLEDGSDPDAQYTIEHHFSSENYDKLEKAAVEAFKLGYEVTDAEELEVEGGQVVLCCDIISECGLTAEHIDAQVEQLARLAEKMDVDYDGWGTYFEDPDAEDEDDDDADEAPLH

Flanking regions ( +/- flanking 50bp)

GGCGCGGCTGTGGGAGAATGCGCGGGTATCACTTATCAGAGGACATGGCCATGTCAGAATTAGATGCGTTTTTAGAAGAACAGCGCGAAGAAACCCGTGCGATTATTGCAGAACTGCTGGAAGACGGCAGCGATCCTGATGCGCAATACACCATTGAACACCATTTTTCGAGTGAGAATTACGACAAGCTGGAAAAAGCGGCAGTTGAAGCTTTCAAACTGGGTTATGAAGTGACAGATGCCGAGGAGCTGGAAGTGGAAGGCGGCCAGGTGGTGTTATGTTGCGATATCATCAGTGAATGCGGGCTGACGGCGGAACATATCGATGCTCAGGTAGAGCAGCTGGCGCGTCTGGCAGAAAAAATGGATGTGGATTACGACGGCTGGGGCACCTATTTCGAAGACCCGGATGCCGAAGATGAAGATGATGACGATGCTGATGAGGCGCCGTTACACTAATCATCTGCCATGACTGAAAAACCTGCCGCGGCAGGTTTTTTTGTGTCTGT