Homologs in group_1005

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_05615 FBDBKF_05615 100.0 Morganella morganii S1 pspF phage shock protein operon transcriptional activator
NLDBIP_12315 NLDBIP_12315 100.0 Morganella morganii S4 pspF phage shock protein operon transcriptional activator
LHKJJB_12175 LHKJJB_12175 100.0 Morganella morganii S3 pspF phage shock protein operon transcriptional activator
HKOGLL_10790 HKOGLL_10790 100.0 Morganella morganii S5 pspF phage shock protein operon transcriptional activator
F4V73_RS03690 F4V73_RS03690 86.6 Morganella psychrotolerans pspF phage shock protein operon transcriptional activator
PMI_RS06650 PMI_RS06650 64.3 Proteus mirabilis HI4320 pspF phage shock protein operon transcriptional activator

Distribution of the homologs in the orthogroup group_1005

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1005

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P37344 8.96e-151 429 63 1 323 1 pspF Psp operon transcriptional activator Escherichia coli (strain K12)
P09570 4.39e-76 245 44 4 313 4 nifA Nif-specific regulatory protein Azotobacter vinelandii
Q06065 3.61e-70 228 41 3 311 1 atoC Regulatory protein AtoC Escherichia coli (strain K12)
P27713 3.7e-70 230 41 6 346 4 nifA Nif-specific regulatory protein Herbaspirillum seropedicae
P30667 7.87e-70 231 50 1 228 1 nifA Nif-specific regulatory protein Azospirillum brasilense
P54929 9.83e-70 231 50 1 228 4 nifA Nif-specific regulatory protein Azospirillum lipoferum
P12627 1.73e-69 228 42 3 303 1 vnfA Nitrogen fixation protein VnfA Azotobacter vinelandii
P71229 1.82e-69 231 52 1 221 1 hyfR DNA-binding transcriptional activator HyfR Escherichia coli (strain K12)
P54930 2.04e-69 228 42 5 312 4 nifA Nif-specific regulatory protein Enterobacter agglomerans
Q9APD9 9.69e-69 224 44 4 296 3 zraR Transcriptional regulatory protein ZraR Klebsiella oxytoca
P14375 1.57e-68 223 43 4 292 1 zraR Transcriptional regulatory protein ZraR Escherichia coli (strain K12)
Q53206 6.09e-68 226 40 5 338 4 nifA Nif-specific regulatory protein Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P25852 7.83e-68 221 42 4 303 1 zraR Transcriptional regulatory protein ZraR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8X613 1.21e-67 221 43 4 292 3 zraR Transcriptional regulatory protein ZraR Escherichia coli O157:H7
P12626 1.64e-66 221 41 4 302 4 anfA Nitrogen fixation protein AnfA Azotobacter vinelandii
Q8Z333 1.84e-66 218 41 3 303 3 zraR Transcriptional regulatory protein ZraR Salmonella typhi
P41789 4.07e-66 218 42 5 321 1 glnG DNA-binding transcriptional regulator NtrC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P03029 4.3e-66 218 41 5 337 1 ntrC DNA-binding transcriptional regulator NtrC Klebsiella pneumoniae
Q04848 7.14e-66 218 40 7 337 3 ntrC DNA-binding transcriptional regulator NtrC Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P56266 9.48e-66 218 41 2 309 3 nifA Nif-specific regulatory protein Klebsiella oxytoca
P03027 1.34e-65 218 41 2 309 1 nifA Nif-specific regulatory protein Klebsiella pneumoniae
P0CY94 3.46e-65 218 40 5 350 4 nifA1 Nif-specific regulatory protein Rhodobacter capsulatus
D5ARW9 3.61e-65 218 40 4 350 4 nifA1 Nif-specific regulatory protein Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
P0AFB8 1.61e-64 214 42 5 321 1 glnG DNA-binding transcriptional regulator NtrC Escherichia coli (strain K12)
P0AFB9 1.61e-64 214 42 5 321 3 glnG DNA-binding transcriptional regulator NtrC Escherichia coli O157:H7
P23747 1.97e-64 213 50 1 218 1 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P24426 4.51e-64 209 47 1 229 4 nifA Nif-specific regulatory protein Rhizobium leguminosarum bv. trifolii
P28787 1.16e-63 211 50 1 211 3 ntrC DNA-binding transcriptional regulator NtrC Proteus hauseri
A6TCX4 3.38e-63 211 39 4 327 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P10577 9.54e-63 209 38 6 337 1 ntrC DNA-binding transcriptional regulator NtrC Rhizobium meliloti (strain 1021)
P29267 1.25e-62 209 40 5 317 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P54931 1.62e-62 211 47 1 229 4 nifA Nif-specific regulatory protein Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B5XVA2 3.81e-62 209 39 4 327 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Klebsiella pneumoniae (strain 342)
B1LQ27 4.13e-62 208 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain SMS-3-5 / SECEC)
P45671 5.03e-62 207 40 6 329 3 ntrC DNA-binding transcriptional regulator NtrC Azospirillum brasilense
P09133 7.44e-62 210 51 1 212 2 nifA Nif-specific regulatory protein Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B7N6T9 8.13e-62 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q0TEH1 8.21e-62 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B6I695 8.57e-62 207 39 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain SE11)
B7LEC0 9.13e-62 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain 55989 / EAEC)
Q3YYF5 9.33e-62 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella sonnei (strain Ss046)
Q31X73 9.43e-62 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella boydii serotype 4 (strain Sb227)
Q1R7Z1 9.53e-62 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain UTI89 / UPEC)
A1AEP9 9.53e-62 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O1:K1 / APEC
B7MKH8 9.53e-62 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O45:K1 (strain S88 / ExPEC)
B1IUX0 1.12e-61 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q00934 1.2e-61 206 39 3 301 1 pilR Response regulator protein PilR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A7ZQD8 1.23e-61 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O139:H28 (strain E24377A / ETEC)
B7M9E6 1.34e-61 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O8 (strain IAI1)
A8A3I6 1.57e-61 207 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O9:H4 (strain HS)
B7LW25 2.72e-61 206 39 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8FEN6 2.93e-61 206 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MZ04 2.93e-61 206 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O81 (strain ED1a)
B7UHC1 3.25e-61 206 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32CL9 4.11e-61 206 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella dysenteriae serotype 1 (strain Sd197)
P59402 4.37e-61 206 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella flexneri
Q0T1D4 4.37e-61 206 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Shigella flexneri serotype 5b (strain 8401)
P10576 5.77e-61 205 39 5 329 3 ntrC DNA-binding transcriptional regulator NtrC Bradyrhizobium sp. (strain RP501 Parasponia)
B7NSI9 1.08e-60 204 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P37013 1.27e-60 204 38 3 318 1 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12)
B1XCN6 1.27e-60 204 38 3 318 2 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12 / DH10B)
C4ZYV4 1.27e-60 204 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli (strain K12 / MC4100 / BW2952)
Q7MFY9 1.29e-60 204 39 4 308 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Vibrio vulnificus (strain YJ016)
B5Z370 1.43e-60 204 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X854 1.43e-60 204 38 3 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Escherichia coli O157:H7
A8ANR6 2.21e-60 204 45 2 240 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A4WDR5 2.43e-60 204 46 1 230 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Enterobacter sp. (strain 638)
Q9I4N3 3.47e-60 202 45 3 242 1 fleR Response regulator protein FleR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P05407 3.61e-60 205 37 3 348 1 nifA Nif-specific regulatory protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3K999 3.92e-60 199 42 7 300 3 sfnR Sigma54-dependent transcriptional regulator SfnR Pseudomonas fluorescens (strain Pf0-1)
Q8D4F9 3.99e-60 203 39 4 308 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Vibrio vulnificus (strain CMCP6)
P17899 4.08e-60 202 38 6 320 4 flbD Transcriptional regulatory protein FlbD Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B5FSZ0 5.84e-60 202 39 4 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella dublin (strain CT_02021853)
P0C5S5 9.91e-60 201 39 5 315 3 luxO Luminescence regulatory protein LuxO Vibrio harveyi
A7MVC2 9.91e-60 201 39 5 315 1 luxO Luminescence regulatory protein LuxO Vibrio campbellii (strain ATCC BAA-1116)
Q88RJ6 1.25e-59 200 46 2 230 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q87MX7 1.98e-59 200 39 6 316 3 luxO Regulatory protein LuxO Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P09828 2.45e-59 201 38 5 333 4 nifA Nif-specific regulatory protein Rhizobium leguminosarum
A8GG93 2.91e-59 201 38 3 320 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Serratia proteamaculans (strain 568)
P19323 3.34e-59 204 42 4 269 1 fhlA Formate hydrogenlyase transcriptional activator FhlA Escherichia coli (strain K12)
Q8Z4C6 3.87e-59 201 39 6 324 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella typhi
A9N0D7 3.87e-59 201 39 6 324 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5RDG4 3.87e-59 201 39 6 324 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QV88 3.87e-59 201 39 6 324 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella enteritidis PT4 (strain P125109)
Q57KT4 3.87e-59 201 39 6 324 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella choleraesuis (strain SC-B67)
Q5PF20 3.95e-59 201 39 6 324 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C0PWN2 4.08e-59 201 39 6 324 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella paratyphi C (strain RKS4594)
A9MFX7 5.2e-59 200 38 4 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
E1WAA4 6.01e-59 204 41 4 270 3 fhlA Formate hydrogenlyase transcriptional activator Salmonella typhimurium (strain SL1344)
B5F363 6.29e-59 200 38 4 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella agona (strain SL483)
P0CL46 6.33e-59 204 41 4 270 1 fhlA Formate hydrogenlyase transcriptional activator Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8ZMJ8 8.02e-59 200 38 4 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TT16 8.02e-59 200 38 4 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella schwarzengrund (strain CVM19633)
A4STH5 9.79e-59 199 50 1 205 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aeromonas salmonicida (strain A449)
Q88AQ2 1.03e-58 198 46 2 230 3 algB Alginate biosynthesis transcriptional regulatory protein AlgB Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P03028 1.28e-58 200 41 6 338 4 nifA Nif-specific regulatory protein Rhizobium meliloti (strain 1021)
Q845S7 1.36e-58 195 40 3 287 2 sfnR Sigma54-dependent transcriptional activator SfnR Pseudomonas putida
P0AFU5 1.68e-58 197 38 5 316 1 qseF Transcriptional regulatory protein QseF Escherichia coli O157:H7
P0AFU4 1.68e-58 197 38 5 316 1 glrR Transcriptional regulatory protein GlrR Escherichia coli (strain K12)
Q9K4U8 1.89e-58 199 46 1 232 2 norR2 Nitric oxide reductase transcription regulator NorR2 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B4TF23 3.66e-58 198 38 4 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella heidelberg (strain SL476)
Q6D8R9 5.99e-58 197 42 3 253 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A0KEJ0 6.89e-58 197 45 2 250 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q9HU19 1.16e-57 196 41 6 308 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B4T3B0 1.17e-57 197 38 4 318 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Salmonella newport (strain SL254)
Q9KT84 1.4e-57 195 38 4 313 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q43965 1.62e-57 197 39 7 338 1 mopR Phenol regulator MopR Acinetobacter guillouiae
P54529 3.29e-57 199 43 2 237 4 yqiR Putative sigma L-dependent transcriptional regulator YqiR Bacillus subtilis (strain 168)
Q7MM78 3.54e-57 194 45 1 230 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain YJ016)
Q8CWJ5 3.54e-57 194 45 1 230 3 luxO Regulatory protein LuxO Vibrio vulnificus (strain CMCP6)
Q5E3W8 3.38e-56 193 44 1 216 3 norR Anaerobic nitric oxide reductase transcription regulator NorR Aliivibrio fischeri (strain ATCC 700601 / ES114)
P06519 4.73e-56 194 38 3 324 4 xylR Transcriptional regulatory protein XylR Pseudomonas putida
O87455 4.96e-56 193 39 4 299 1 luxO Regulatory protein LuxO Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
O85057 7.49e-55 190 41 8 303 1 None Limonene hydroxylase Geobacillus stearothermophilus
G3XCV0 8.17e-55 189 44 1 229 1 fleQ Transcriptional regulator FleQ Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P26047 1.9e-54 191 35 4 303 4 stc Signal-transduction and transcriptional-control protein Clostridium beijerinckii
Q46802 2.58e-54 189 44 2 214 4 uacR Putative uric acid sigma-54-dependent transcriptional regulator UacR Escherichia coli (strain K12)
P74839 4.01e-54 188 39 8 308 4 prpR Propionate catabolism operon regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9ZIB7 1.17e-51 181 40 2 234 1 tyrR HTH-type transcriptional regulatory protein TyrR Enterobacter agglomerans
Q9K4V0 3.24e-51 180 45 1 232 2 norR1 Nitric oxide reductase transcription regulator NorR1 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q9KN48 3.39e-50 177 39 2 268 4 vasH Transcriptional regulator VasH Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P77743 3.83e-50 177 45 5 223 1 prpR Propionate catabolism operon regulatory protein Escherichia coli (strain K12)
P0A2D7 1.06e-49 176 40 2 230 3 tyrR HTH-type transcriptional regulatory protein TyrR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2D8 1.06e-49 176 40 2 230 3 tyrR HTH-type transcriptional regulatory protein TyrR Salmonella typhi
P38022 1.12e-49 174 36 5 321 1 rocR Transcriptional activator RocR Bacillus subtilis (strain 168)
O54426 1.62e-49 175 39 2 230 3 tyrR HTH-type transcriptional regulatory protein TyrR Citrobacter braakii
P31908 2.44e-49 174 40 3 298 3 hoxA Hydrogenase transcriptional regulatory protein HoxA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
O25408 4.71e-49 171 42 4 225 1 flgR Transcriptional regulatory protein FlgR Helicobacter pylori (strain ATCC 700392 / 26695)
P07604 7.9e-49 173 39 2 230 1 tyrR HTH-type transcriptional regulatory protein TyrR Escherichia coli (strain K12)
P13632 6.97e-48 170 45 1 204 1 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium meliloti (strain 1021)
P10046 9.29e-48 169 45 1 206 3 dctD C4-dicarboxylate transport transcriptional regulatory protein DctD Rhizobium leguminosarum
O31551 9.65e-47 169 36 6 317 2 acoR Acetoin dehydrogenase operon transcriptional activator AcoR Bacillus subtilis (strain 168)
P37931 1.08e-45 160 40 2 211 4 hrpS Pathogenicity locus probable regulatory protein HrpS Pseudomonas syringae pv. syringae
P26316 7.31e-45 158 40 4 234 4 hrpS Pathogenicity locus probable regulatory protein HrpS Pseudomonas savastanoi pv. phaseolicola
Q04849 7.71e-44 159 33 4 306 3 ntrX Nitrogen assimilation regulatory protein NtrX Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q01265 8.7e-44 155 38 3 223 4 None Uncharacterized protein in HyuA 5'region (Fragment) Pseudomonas sp. (strain NS671)
P28614 1.76e-43 161 39 5 264 1 acoR Acetoin catabolism regulatory protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P37930 1.14e-42 152 41 2 200 4 hrpR Pathogenicity locus probable regulatory protein HrpR Pseudomonas syringae pv. syringae
P44694 1.37e-42 152 39 2 219 1 tyrR HTH-type transcriptional regulatory protein TyrR Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P26408 9.27e-40 149 33 5 320 1 hupR1 Hydrogenase transcriptional regulatory protein HupR1 Rhodobacter capsulatus
P36219 4.57e-39 143 38 4 228 4 wtsA Pathogenicity locus probable regulatory protein WtsA Pantoea stewartii subsp. stewartii
Q68WH4 5.73e-33 130 28 6 315 3 RT0550 Putative response regulator NtrX-like Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCY9 1.62e-32 129 28 6 312 3 RP562 Putative response regulator NtrX-like Rickettsia prowazekii (strain Madrid E)
Q4UL27 7.39e-32 127 27 7 328 3 RF_0895 Putative response regulator NtrX-like Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q1RJS1 3.96e-29 119 26 6 326 3 RBE_0312 Putative response regulator NtrX-like Rickettsia bellii (strain RML369-C)
P45512 3.3e-28 118 30 7 286 4 dhaR Glycerol metabolism operon regulatory protein Citrobacter freundii
P54156 7.37e-28 114 33 7 245 2 yplP Putative sigma L-dependent transcriptional regulator YplP Bacillus subtilis (strain 168)
P38035 1.39e-27 115 33 7 257 4 rtcR Transcriptional regulatory protein RtcR Escherichia coli (strain K12)
Q92HC2 6.26e-26 110 26 5 320 3 RC0849 Putative response regulator NtrX-like Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P76016 7.11e-26 111 33 2 209 1 dhaR PTS-dependent dihydroxyacetone kinase operon regulatory protein Escherichia coli (strain K12)
P55610 8.57e-25 108 28 8 324 4 NGR_a02110 Putative transcriptional regulatory protein y4pA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P09432 3.55e-20 94 29 5 244 3 ntrC DNA-binding transcriptional regulator NtrC Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
D0ZLR9 9.57e-20 93 39 5 154 2 dgaR Transcriptional regulatory protein DagR Salmonella typhimurium (strain 14028s / SGSC 2262)
P23914 1.31e-19 93 37 6 160 3 levR Transcriptional regulatory protein LevR Bacillus subtilis (strain 168)
P06184 5.23e-06 51 23 9 321 3 pgtA Phosphoglycerate transport system transcriptional regulatory protein PgtA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P56269 2.47e-05 46 27 4 125 3 nifA Nif-specific regulatory protein (Fragment) Azotobacter chroococcum mcd 1

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_11975
Feature type CDS
Gene pspF
Product phage shock protein operon transcriptional activator
Location 50591 - 51577 (strand: -1)
Length 987 (nucleotides) / 328 (amino acids)

Contig

Accession ZDB_221
Length 181491 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1005
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00158 Sigma-54 interaction domain
PF02954 Bacterial regulatory protein, Fis family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3829 Transcription (K)
Signal transduction mechanisms (T)		 KT RocR-type transcriptional regulator, contains PAS, AAA-type ATPase, and DNA-binding Fis domains

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03974 psp operon transcriptional activator - -

Protein Sequence

MKNNTETLIGIDNTFLDALEKVSRLAKIARPVLICGERGTGKELFAHRLHYLSPRWDEPFIALNCAALNDNLLDSELFGHESGAFTGAQRRHQGRFERADGGTLFLDELGTAPLTVQEKLLRVIEYGEFERVGGQQTLKADVRIVCATNADLPALAAEGKFRPDLLDRLAFDVVNIPPLRERPRDLTELAGHFAVQMCQEMGTPFFAGFSPHALQQMQSYHWPGNIRELKNVIERSLYRQGDTTEPLAELVINPFVTAPAPSADAAAQALPPLPFSLKQWQHTQEKDALDAALQRAQFNQREAAQLLNLTYHQFRGLLKKHAGSPQPD

Flanking regions ( +/- flanking 50bp)

ATGACTTTTTGTAAAGTGGTAACATTCGCCATTTAGTGGTCAAATTAATCATGAAAAATAATACAGAAACCCTGATCGGTATTGATAATACCTTCCTCGATGCACTGGAAAAAGTGTCGCGGCTGGCAAAAATTGCCCGGCCGGTACTGATTTGCGGAGAACGGGGTACCGGTAAAGAATTATTTGCTCACCGTCTTCATTATCTCTCTCCGCGCTGGGATGAGCCATTTATTGCGCTGAATTGTGCGGCACTTAACGATAATTTGCTCGATTCCGAGCTGTTCGGACATGAATCCGGGGCTTTTACAGGGGCTCAGCGCCGCCATCAGGGTCGTTTTGAGAGAGCGGACGGCGGCACACTGTTTCTTGATGAACTGGGTACTGCGCCGCTGACCGTGCAGGAAAAACTGTTGCGGGTGATTGAATACGGGGAATTTGAGCGGGTCGGCGGACAGCAGACCCTGAAAGCGGATGTACGGATTGTCTGCGCCACCAATGCGGATTTACCGGCGCTGGCGGCAGAGGGAAAATTCCGCCCCGATTTACTCGACCGGCTGGCCTTTGATGTCGTCAATATCCCGCCGCTGCGCGAGCGCCCGCGCGACCTGACCGAACTCGCCGGTCATTTTGCCGTGCAGATGTGTCAGGAGATGGGCACGCCGTTTTTTGCCGGTTTTTCCCCGCACGCCCTGCAACAGATGCAGAGCTATCACTGGCCGGGCAATATCCGTGAGCTGAAAAATGTGATTGAGCGATCTTTGTACCGTCAGGGAGATACCACCGAACCGCTGGCAGAATTGGTGATCAACCCGTTTGTCACTGCGCCGGCTCCTTCAGCGGACGCCGCCGCACAGGCTCTGCCGCCGCTGCCGTTCTCCCTGAAGCAGTGGCAGCATACACAGGAGAAGGACGCGCTGGATGCCGCATTACAGCGCGCGCAGTTTAATCAGCGGGAAGCAGCACAATTGCTGAATCTGACCTATCATCAGTTTCGCGGATTACTGAAAAAACATGCCGGCAGCCCGCAACCGGATTAAATGCTTCCGTTTTTGGTTAGTCGCACAAATTGCGATACAATGCCCTGTTC