Homologs in group_2439

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19940 FBDBKF_19940 100.0 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_08000 NLDBIP_08000 100.0 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_06265 LHKJJB_06265 100.0 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_19120 HKOGLL_19120 100.0 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
F4V73_RS02425 F4V73_RS02425 67.3 Morganella psychrotolerans - CerR family C-terminal domain-containing protein
PMI_RS09200 PMI_RS09200 53.6 Proteus mirabilis HI4320 - CerR family C-terminal domain-containing protein

Distribution of the homologs in the orthogroup group_2439

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2439

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACU1 2.12e-21 91 30 4 205 3 cecR HTH-type transcriptional dual regulator CecR Shigella flexneri
P0ACU0 2.12e-21 91 30 4 205 1 cecR HTH-type transcriptional dual regulator CecR Escherichia coli (strain K12)
O34970 5.63e-05 46 27 1 80 1 yttP Probable HTH-type transcriptional regulator YttP Bacillus subtilis (strain 168)
Q9R9T9 0.00011 45 38 0 55 1 srpR HTH-type transcriptional regulator SrpR Pseudomonas putida
Q8X4Z7 0.000412 43 32 0 70 3 rutR HTH-type transcriptional regulator RutR Escherichia coli O157:H7
P0ACU4 0.000428 43 32 0 70 3 rutR HTH-type transcriptional regulator RutR Shigella flexneri
P0ACU2 0.000428 43 32 0 70 1 rutR HTH-type transcriptional regulator RutR Escherichia coli (strain K12)
P0ACU3 0.000428 43 32 0 70 3 rutR HTH-type transcriptional regulator RutR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P39897 0.000525 43 27 0 69 1 mtrR HTH-type transcriptional regulator MtrR Neisseria gonorrhoeae
Q93PU7 0.000695 42 34 0 55 1 ttgW Uncharacterized HTH-type transcriptional regulator TtgW Pseudomonas putida (strain DOT-T1E)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_07675
Feature type CDS
Gene acrR
Product DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
Location 6850 - 7512 (strand: 1)
Length 663 (nucleotides) / 220 (amino acids)

Contig

Accession ZDB_217
Length 250991 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2439
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF09209 HTH-type transcriptional dual regulator CecR, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K23777 TetR/AcrR family transcriptional regulator, regulator of cefoperazone and chloramphenicol sensitivity - -

Protein Sequence

MNKHTLSSEQTREKLIQAGIRLFALSGVSGVRTRQLAEEAGVNQSAIPYHLGGKSGVYAAVIRKITDDLAAVTDVSRIDAATEALTAQEQPGKTALKTVLVSMVSGLCKALLSPERALYGTLILREQLEQTENYDVIYQSFIEPFHKRLSLLAQLADPQADTKTTIIRAHALIGQILGFVVAQKAYLCRSEAKSVSEDELAEITGQIVLLSCRALGLDEA

Flanking regions ( +/- flanking 50bp)

ATGCGTGCTGATCTCTGATTATACCGGTGAATCTGCAGATGACGGAAAAGATGAATAAACATACGCTCTCCTCAGAGCAGACCAGAGAGAAACTGATACAGGCGGGGATCCGCCTGTTTGCCCTCAGCGGTGTCAGCGGTGTCCGGACCCGGCAGCTGGCGGAGGAGGCGGGTGTGAATCAGTCAGCTATTCCGTATCATCTGGGCGGTAAGTCGGGGGTGTATGCCGCAGTGATCCGGAAAATTACTGATGATCTGGCCGCTGTGACGGATGTCAGCAGGATCGATGCTGCCACAGAGGCACTGACGGCACAGGAGCAGCCGGGCAAAACGGCACTGAAAACAGTACTGGTCAGTATGGTCTCCGGGCTGTGTAAGGCATTGTTATCGCCGGAACGCGCTCTGTACGGCACGCTGATCCTGCGGGAACAGCTGGAGCAGACTGAAAATTATGATGTGATTTATCAGTCATTTATTGAACCCTTTCATAAGCGGCTCTCTCTGCTGGCACAGCTTGCAGACCCGCAGGCGGATACAAAAACAACCATTATCAGGGCGCATGCCCTGATAGGGCAGATTCTGGGGTTTGTGGTGGCACAAAAGGCGTATCTGTGCCGCAGTGAAGCGAAATCTGTCAGTGAGGATGAACTGGCGGAAATCACCGGGCAGATTGTACTGCTTTCCTGCCGGGCTCTGGGACTGGATGAGGCGTGAATGACAGTGCCGGAGAGTATCCGGCACTGTATTGTCGTGATTACCAGCCG