Homologs in group_715

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03115 FBDBKF_03115 100.0 Morganella morganii S1 sspB ClpXP protease specificity-enhancing factor
NLDBIP_07745 NLDBIP_07745 100.0 Morganella morganii S4 sspB ClpXP protease specificity-enhancing factor
LHKJJB_07280 LHKJJB_07280 100.0 Morganella morganii S3 sspB ClpXP protease specificity-enhancing factor
HKOGLL_03650 HKOGLL_03650 100.0 Morganella morganii S5 sspB ClpXP protease specificity-enhancing factor
F4V73_RS11805 F4V73_RS11805 87.7 Morganella psychrotolerans sspB ClpXP protease specificity-enhancing factor
PMI_RS18270 PMI_RS18270 64.4 Proteus mirabilis HI4320 sspB ClpXP protease specificity-enhancing factor

Distribution of the homologs in the orthogroup group_715

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_715

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AFZ3 3.02e-62 192 79 0 111 1 sspB Stringent starvation protein B Escherichia coli (strain K12)
P0AFZ4 3.02e-62 192 79 0 111 3 sspB Stringent starvation protein B Escherichia coli O157:H7
Q83Q08 8.67e-61 188 78 0 111 3 sspB Stringent starvation protein B Shigella flexneri
P45206 1.71e-45 149 60 0 105 1 sspB Stringent starvation protein B homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_07420
Feature type CDS
Gene sspB
Product ClpXP protease specificity-enhancing factor
Location 220315 - 220803 (strand: 1)
Length 489 (nucleotides) / 162 (amino acids)

Contig

Accession ZDB_216
Length 269970 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_715
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04386 Stringent starvation protein B

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2969 Posttranslational modification, protein turnover, chaperones (O) O Stringent starvation protein B, binds SsrA peptide

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03600 stringent starvation protein B - -

Protein Sequence

MDIQELTPRRPYLLRAHYEWLLDNELTPHLVVDVNTPGVNVPMEYAQDGQIVLNIAPRAVGNLEMTNEWVGFNARFGGVPRQVDVPMAAIIAVYARENGAGMMFEPEVAYEAAEEEDILTPAVDNITLIHDEPVKPAEESTDGDDPEPPKPPRGRPNLRVVK

Flanking regions ( +/- flanking 50bp)

TGACGGAAGCTGAGCGTGAGATGCGTTTACAGTCACGGGGTTAACCGCTGATGGATATTCAGGAATTAACACCGCGCCGCCCTTATCTGCTGCGGGCGCACTATGAATGGTTACTGGATAATGAACTGACACCCCATCTGGTGGTGGATGTGAACACCCCCGGTGTGAATGTGCCGATGGAGTATGCTCAGGATGGTCAGATTGTCCTGAATATTGCACCGCGCGCTGTGGGTAATCTTGAAATGACCAACGAGTGGGTCGGTTTTAATGCCCGTTTCGGCGGTGTTCCGCGCCAGGTGGATGTGCCGATGGCTGCCATTATTGCGGTCTACGCCCGTGAAAACGGTGCCGGGATGATGTTTGAGCCGGAAGTGGCTTATGAGGCTGCGGAAGAAGAAGATATTCTGACTCCGGCAGTGGATAACATTACCCTGATCCACGACGAACCGGTAAAACCGGCGGAAGAAAGCACCGACGGGGATGACCCGGAGCCGCCGAAACCACCGCGTGGCCGTCCGAACTTACGTGTCGTGAAGTAACAGACCGATAAATAAAAAAGACCGCGAAAGCGGTCTTTTTTGCATTTAAG