Homologs in group_2657

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04585 FBDBKF_04585 100.0 Morganella morganii S1 clcA H(+)/Cl(-) exchange transporter ClcA
NLDBIP_06195 NLDBIP_06195 100.0 Morganella morganii S4 clcA H(+)/Cl(-) exchange transporter ClcA
LHKJJB_03075 LHKJJB_03075 100.0 Morganella morganii S3 clcA H(+)/Cl(-) exchange transporter ClcA
HKOGLL_06550 HKOGLL_06550 100.0 Morganella morganii S5 clcA H(+)/Cl(-) exchange transporter ClcA
PMI_RS10420 PMI_RS10420 67.8 Proteus mirabilis HI4320 clcA H(+)/Cl(-) exchange transporter ClcA

Distribution of the homologs in the orthogroup group_2657

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2657

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A9N0Q1 0.0 581 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SUY5 0.0 581 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella newport (strain SL254)
B5R3G7 0.0 581 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella enteritidis PT4 (strain P125109)
B5RHE1 0.0 580 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella gallinarum (strain 287/91 / NCTC 13346)
A8ALD3 0.0 580 64 1 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q8ZRP8 0.0 579 65 1 444 1 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TXQ7 0.0 579 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella schwarzengrund (strain CVM19633)
B4TK31 0.0 579 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella heidelberg (strain SL476)
B5FJ02 0.0 579 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella dublin (strain CT_02021853)
B5F8R6 0.0 579 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella agona (strain SL483)
Q8Z9B3 0.0 577 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella typhi
A9MPK6 0.0 577 65 1 444 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
C0Q5R6 0.0 577 64 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella paratyphi C (strain RKS4594)
Q57T52 0.0 577 64 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella choleraesuis (strain SC-B67)
B5BL83 0.0 575 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella paratyphi A (strain AKU_12601)
Q5PD50 0.0 575 65 1 446 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5Y1L4 0.0 570 66 0 437 3 clcA H(+)/Cl(-) exchange transporter ClcA Klebsiella pneumoniae (strain 342)
A6T4V9 0.0 543 66 0 437 3 clcA H(+)/Cl(-) exchange transporter ClcA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MGR4 1.61e-175 503 60 0 461 3 clcA H(+)/Cl(-) exchange transporter ClcA Cronobacter sakazakii (strain ATCC BAA-894)
B2K549 7.72e-174 499 59 1 456 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FM08 2.04e-173 498 59 1 456 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JK21 2.25e-173 498 59 1 456 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TPW7 2.25e-173 498 59 1 456 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis (strain Pestoides F)
Q1CLU6 2.25e-173 498 59 1 456 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E4 2.25e-173 498 59 1 456 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBM0 2.25e-173 498 59 1 456 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis
Q1C3X2 2.25e-173 498 59 1 456 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis bv. Antiqua (strain Antiqua)
B7LWB6 2.79e-170 490 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q3Z5K2 8.49e-170 489 62 0 430 1 clcA H(+)/Cl(-) exchange transporter ClcA Shigella sonnei (strain Ss046)
B6HZD1 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain SE11)
B7N824 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P37019 8.49e-170 489 62 0 430 1 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain K12)
B1IQI5 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XD25 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain K12 / DH10B)
C4ZRP8 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M196 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O8 (strain IAI1)
B7LGL7 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain 55989 / EAEC)
B7UIK2 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHP7 8.49e-170 489 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32JV3 1e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella dysenteriae serotype 1 (strain Sd197)
B1LGV8 1e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain SMS-3-5 / SECEC)
Q0TLH6 1e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MP17 1e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O81 (strain ED1a)
B7NIB8 1e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0D5 1e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58244 1e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O157:H7
A7ZWA3 1.07e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O9:H4 (strain HS)
Q1RG33 1.13e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain UTI89 / UPEC)
Q8FL15 1.13e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A7K1 1.13e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O1:K1 / APEC
B7MBD8 1.13e-169 488 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O45:K1 (strain S88 / ExPEC)
Q325Y4 3.32e-169 487 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella boydii serotype 4 (strain Sb227)
B2U300 2.05e-168 485 61 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P59639 1.28e-167 483 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella flexneri
Q0T851 1.28e-167 483 62 0 430 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella flexneri serotype 5b (strain 8401)
Q87GZ9 7.41e-149 435 56 0 435 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LVE3 1.45e-147 432 53 1 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio cholerae serotype O1 (strain M66-2)
Q9KM62 1.45e-147 432 53 1 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F0D5 3.45e-147 431 53 1 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MDF0 1.06e-135 402 56 0 425 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio vulnificus (strain YJ016)
Q8D6J0 1.06e-135 402 56 0 425 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio vulnificus (strain CMCP6)
A7N6K9 3.04e-134 398 55 0 423 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio campbellii (strain ATCC BAA-1116)
Q8XTT4 9.37e-30 123 30 4 325 3 RSp0020 Putative chloride channel protein ClcB-like Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8RXR2 1.02e-25 114 31 9 319 2 CLC-F Chloride channel protein CLC-f Arabidopsis thaliana
Q8GX93 1.44e-23 107 27 18 444 2 CLC-E Chloride channel protein CLC-e Arabidopsis thaliana
Q8ZEB3 2.1e-22 102 32 13 328 3 clcB Voltage-gated ClC-type chloride channel ClcB Yersinia pestis
A8AGW0 2.58e-22 102 29 7 324 3 clcB Voltage-gated ClC-type chloride channel ClcB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9AGD5 4.34e-22 101 32 13 328 3 clcB Voltage-gated ClC-type chloride channel ClcB Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FHW4 4.34e-22 101 32 13 328 3 clcB Voltage-gated ClC-type chloride channel ClcB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q54C67 8.64e-19 93 25 16 445 3 clcF Chloride channel protein F Dictyostelium discoideum
Q61418 5.8e-17 87 24 17 443 2 Clcn4 H(+)/Cl(-) exchange transporter 4 Mus musculus
P51794 1.83e-16 85 24 17 443 2 Clcn4 H(+)/Cl(-) exchange transporter 4 Rattus norvegicus
P92942 2.37e-16 85 26 8 269 1 CLC-B Chloride channel protein CLC-b Arabidopsis thaliana
P51793 3.1e-16 85 24 17 443 1 CLCN4 H(+)/Cl(-) exchange transporter 4 Homo sapiens
Q86AZ6 5.92e-16 84 20 15 528 3 clcB Chloride channel protein B Dictyostelium discoideum
P92941 7.36e-16 84 26 7 267 1 CLC-A Chloride channel protein CLC-a Arabidopsis thaliana
P59638 8.97e-16 82 30 5 256 3 clcB Voltage-gated ClC-type chloride channel ClcB Shigella flexneri
B7NB42 1.01e-15 82 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7NUP7 1.13e-15 82 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q9WVD4 1.28e-15 83 23 14 425 1 Clcn5 H(+)/Cl(-) exchange transporter 5 Mus musculus
A8A0D3 1.51e-15 82 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O9:H4 (strain HS)
Q9GKE7 1.66e-15 82 23 16 425 2 CLCN5 H(+)/Cl(-) exchange transporter 5 Sus scrofa
P51796 1.69e-15 82 23 14 425 2 Clcn5 H(+)/Cl(-) exchange transporter 5 Rattus norvegicus
P76175 1.69e-15 81 29 12 421 1 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain K12)
B1XF57 1.69e-15 81 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain K12 / DH10B)
C4ZY54 1.69e-15 81 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain K12 / MC4100 / BW2952)
B1IQZ8 1.71e-15 81 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7LZY4 1.71e-15 81 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O8 (strain IAI1)
B7L5E4 1.71e-15 81 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain 55989 / EAEC)
A7ZM51 1.71e-15 81 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q64347 2.07e-15 82 25 13 394 1 Clcn1 Chloride channel protein 1 Mus musculus
Q9VGH7 2.21e-15 82 26 16 390 2 ClC-a Chloride channel protein 2 Drosophila melanogaster
B1LEU5 2.29e-15 81 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain SMS-3-5 / SECEC)
B7URT1 2.67e-15 81 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5Z428 2.95e-15 80 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X794 2.95e-15 80 29 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O157:H7
Q5RBK4 3.11e-15 82 23 15 425 2 CLCN5 H(+)/Cl(-) exchange transporter 5 Pongo abelii
P51795 3.36e-15 82 23 15 425 1 CLCN5 H(+)/Cl(-) exchange transporter 5 Homo sapiens
Q9TTU3 6.31e-15 80 23 16 425 2 CLCN5 H(+)/Cl(-) exchange transporter 5 Oryctolagus cuniculus
P35524 7.78e-15 80 25 13 394 1 Clcn1 Chloride channel protein 1 Rattus norvegicus
Q57753 8.62e-15 79 24 11 383 3 MJ0305 Uncharacterized protein MJ0305 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P35523 8.86e-15 80 24 14 420 1 CLCN1 Chloride channel protein 1 Homo sapiens
Q8ZPK5 9.96e-15 79 31 4 189 3 clcB Voltage-gated ClC-type chloride channel ClcB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9R279 1.03e-14 80 24 17 431 2 CLCN3 H(+)/Cl(-) exchange transporter 3 Cavia porcellus
P51792 1.17e-14 80 24 17 431 2 Clcn3 H(+)/Cl(-) exchange transporter 3 Rattus norvegicus
O18894 1.17e-14 80 24 17 431 2 CLCN3 H(+)/Cl(-) exchange transporter 3 Oryctolagus cuniculus
P51790 1.17e-14 80 24 17 431 1 CLCN3 H(+)/Cl(-) exchange transporter 3 Homo sapiens
P51791 1.26e-14 80 24 17 431 1 Clcn3 H(+)/Cl(-) exchange transporter 3 Mus musculus
B5FHR3 1.91e-14 78 31 4 189 3 clcB Voltage-gated ClC-type chloride channel ClcB Salmonella dublin (strain CT_02021853)
Q8FHC1 2.08e-14 78 29 5 256 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MV39 2.08e-14 78 29 5 256 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O81 (strain ED1a)
B2U1Q2 3.13e-14 77 28 12 421 3 clcB Voltage-gated ClC-type chloride channel ClcB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8Z6Y0 3.14e-14 77 31 4 189 3 clcB Voltage-gated ClC-type chloride channel ClcB Salmonella typhi
Q99P66 6.22e-14 77 23 15 425 2 CLCN5 H(+)/Cl(-) exchange transporter 5 Cavia porcellus
P60300 2.25e-13 76 33 2 127 1 CLC-G Putative chloride channel-like protein CLC-g Arabidopsis thaliana
Q5RDJ7 3.06e-13 75 24 16 416 2 CLCN3 H(+)/Cl(-) exchange transporter 3 Pongo abelii
P0C197 1.68e-12 73 25 15 428 3 UMAG_11084 Probable chloride channel protein UM03490-D Ustilago maydis (strain 521 / FGSC 9021)
P35522 1.79e-12 73 26 18 416 1 None Chloride channel protein Tetronarce californica
P21564 1.8e-12 73 25 18 416 1 None Chloride channel protein Torpedo marmorata
O60159 3.18e-12 72 24 17 433 3 SPBC19C7.11 Putative anion/proton exchange transporter C19C7.11 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q96282 1.31e-11 70 25 17 459 1 CLC-C Chloride channel protein CLC-c Arabidopsis thaliana
P92943 1.51e-11 70 30 5 233 1 CLC-D Chloride channel protein CLC-d Arabidopsis thaliana
Q9MZT1 1.85e-11 70 24 14 398 1 CLCN1 Chloride channel protein 1 Canis lupus familiaris
Q9W701 8.4e-11 67 24 18 413 1 clcnkb Chloride channel protein ClC-Kb Xenopus laevis
P35525 8.84e-11 68 26 14 402 1 Clcn2 Chloride channel protein 2 Rattus norvegicus
Q9R0A1 1.16e-10 67 26 14 402 1 Clcn2 Chloride channel protein 2 Mus musculus
P51789 1.33e-10 67 26 14 402 2 CLCN2 Chloride channel protein 2 Oryctolagus cuniculus
P51788 1.59e-10 67 26 14 402 1 CLCN2 Chloride channel protein 2 Homo sapiens
P37020 1.68e-10 67 21 17 487 1 GEF1 Anion/proton exchange transporter GEF1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
O94287 2.78e-10 66 23 14 430 3 SPBC887.02 Uncharacterized chloride channel protein C887.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q75JF3 4.9e-10 65 32 2 117 3 clcC Chloride channel protein C Dictyostelium discoideum
Q75JF3 1.8e-05 51 26 4 117 3 clcC Chloride channel protein C Dictyostelium discoideum
Q9WU45 1.6e-09 63 38 3 110 1 CLCN2 Chloride channel protein 2 Cavia porcellus
Q9BMK9 5.58e-09 62 37 3 110 1 clh-3 Chloride channel protein clh-3 Caenorhabditis elegans
Q54LQ4 8.23e-09 62 30 3 141 3 clcE Chloride channel protein E Dictyostelium discoideum
Q54AX6 5.27e-08 59 26 4 215 2 clcA Chloride channel protein A Dictyostelium discoideum
P51803 9.08e-08 58 23 15 409 2 CLCNKA Chloride channel protein ClC-Ka Oryctolagus cuniculus
P51804 1.23e-07 57 23 15 409 2 CLCNKB Chloride channel protein ClC-Kb Oryctolagus cuniculus
Q87WD2 1.57e-07 57 23 8 328 1 eriC Chloride/fluoride channel protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q1ZXJ0 3.26e-07 56 32 3 136 3 clcD Chloride channel protein D Dictyostelium discoideum
Q1ZXJ0 0.00039 47 27 2 97 3 clcD Chloride channel protein D Dictyostelium discoideum
Q9TT16 1.04e-06 55 22 14 422 2 CLCN6 H(+)/Cl(-) exchange transporter 6 Oryctolagus cuniculus
O70496 6.95e-06 52 21 20 516 1 Clcn7 H(+)/Cl(-) exchange transporter 7 Mus musculus
P51799 7.52e-06 52 21 20 516 2 Clcn7 H(+)/Cl(-) exchange transporter 7 Rattus norvegicus
Q9WUB7 4.75e-05 49 23 16 408 1 Clcnka Chloride channel protein ClC-Ka Mus musculus
P51797 0.000107 48 21 14 424 1 CLCN6 H(+)/Cl(-) exchange transporter 6 Homo sapiens
Q06393 0.000118 48 23 16 405 1 Clcnka Chloride channel protein ClC-Ka Rattus norvegicus
Q4VFY6 0.00069 45 24 8 292 3 sycA Symbiosis-assisting ClC homolog Rhizobium tropici

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_05875
Feature type CDS
Gene clcA
Product H(+)/Cl(-) exchange transporter ClcA
Location 174570 - 175970 (strand: 1)
Length 1401 (nucleotides) / 466 (amino acids)

Contig

Accession ZDB_215
Length 284267 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2657
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00654 Voltage gated chloride channel

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0038 Inorganic ion transport and metabolism (P) P H+/Cl- antiporter ClcA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03281 chloride channel protein, CIC family - -

Protein Sequence

MSDALPHTTATLKRRYRVLKRLKERNLAPVTVLLLAAAVGALAGFTGVLFERGVNWVGEYRVSSLSSLTDNKEILIPLMFIVSALLAMSGYWLVRRFSPESGGSGIPEIEGALQDVRPVRWWRVLPVKFIGGLGTLGSGMVLGREGPTVQLGANISGLVSALAGVKNQESRHTLLATGAAAGLTAAFNAPLAGILFIIEEMRPQFRYSLISIKAVFIGVIMSSIVFQTFNSGAPILDIGKYHAAPLNTLWLYLVLGMVFGVIGVMFNRFLLTMQTQFRRFYQDKTSRFVATGGLIGGLCGIAGLYWPQVTGGGFAVIPDVAALHYSLTGILMIFLFRVLTTVICFSSGAPGGIFAPTLALGTLFGSFFGYAAMLLFPQYQIEPATFAIAGMGALFAATVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQYLGGRPLYSVLLERILMQNGTPPEKTGDAPRG

Flanking regions ( +/- flanking 50bp)

TTGAATTAAAATAGTGATTAATTTTTATTTAGAATGGATCATGTTCAGCCATGTCAGATGCTTTACCGCATACGACAGCCACGCTTAAACGCCGTTATCGTGTGCTCAAACGCCTTAAAGAACGCAATCTCGCCCCTGTTACTGTCCTGCTGCTGGCGGCTGCCGTCGGCGCACTCGCCGGTTTTACCGGTGTGCTGTTTGAACGCGGGGTCAATTGGGTTGGTGAATACCGGGTCAGCTCTCTGTCTTCACTGACAGATAATAAAGAAATACTTATCCCGCTGATGTTCATTGTTTCCGCCCTGCTGGCCATGTCAGGTTACTGGCTGGTGCGCCGTTTTTCACCGGAATCCGGCGGGTCGGGGATCCCGGAAATTGAAGGGGCATTGCAGGATGTCCGCCCGGTACGCTGGTGGCGGGTGCTGCCGGTAAAATTTATCGGCGGGCTGGGTACTCTCGGCTCCGGTATGGTGCTGGGGCGTGAAGGCCCGACCGTGCAGTTAGGGGCAAATATCAGCGGGCTGGTCAGTGCGCTGGCCGGGGTGAAAAACCAGGAATCCCGCCACACATTGCTGGCCACCGGTGCCGCCGCCGGTCTGACCGCCGCCTTTAACGCACCGCTCGCAGGGATCCTGTTTATCATTGAGGAAATGCGTCCGCAGTTCCGTTACAGCCTGATTTCCATCAAAGCCGTTTTTATCGGCGTAATCATGTCGAGCATTGTTTTTCAGACCTTTAACAGCGGCGCGCCGATTCTGGATATCGGTAAATACCATGCCGCCCCGCTGAATACTCTCTGGCTCTATCTGGTGCTGGGAATGGTTTTCGGTGTGATTGGTGTGATGTTTAACCGCTTTCTGCTCACCATGCAGACACAGTTCCGCCGTTTTTATCAGGATAAAACATCCCGTTTTGTTGCCACCGGCGGTCTGATTGGCGGGTTATGCGGCATTGCCGGGCTGTACTGGCCGCAGGTAACCGGCGGCGGATTCGCGGTGATCCCGGATGTCGCTGCGCTGCACTACTCCCTGACCGGTATTCTGATGATCTTCCTGTTCCGTGTGCTCACCACGGTTATCTGCTTCAGTTCCGGTGCGCCGGGCGGGATCTTCGCGCCGACACTCGCACTCGGCACACTATTCGGCAGTTTCTTCGGCTATGCCGCCATGCTGCTGTTTCCGCAGTATCAGATTGAACCGGCGACCTTTGCCATTGCAGGCATGGGGGCTCTCTTTGCCGCCACCGTCCGTGCGCCGCTTACCGGTATTGTGCTGGTGCTGGAGATGACCGATAACTATCAGCTGATCCTGCCGATGATTATCACATGTCTGGGGGCAACACTGCTGGCGCAGTATCTGGGCGGACGTCCGCTGTATTCGGTACTGCTGGAGCGGATCCTGATGCAGAACGGCACGCCGCCGGAAAAAACCGGTGACGCGCCGCGAGGGTAATATTAATCAGGCTTTTTTGCGGGCAATCAGGGTGGCAAAATTTAATCGGA