Homologs in group_2683

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04585 FBDBKF_04585 67.8 Morganella morganii S1 clcA H(+)/Cl(-) exchange transporter ClcA
EHELCC_05875 EHELCC_05875 67.8 Morganella morganii S2 clcA H(+)/Cl(-) exchange transporter ClcA
NLDBIP_06195 NLDBIP_06195 67.8 Morganella morganii S4 clcA H(+)/Cl(-) exchange transporter ClcA
LHKJJB_03075 LHKJJB_03075 67.8 Morganella morganii S3 clcA H(+)/Cl(-) exchange transporter ClcA
HKOGLL_06550 HKOGLL_06550 67.8 Morganella morganii S5 clcA H(+)/Cl(-) exchange transporter ClcA

Distribution of the homologs in the orthogroup group_2683

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2683

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A9N0Q1 0.0 570 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SUY5 0.0 570 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella newport (strain SL254)
B5RHE1 0.0 570 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3G7 0.0 570 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella enteritidis PT4 (strain P125109)
A9MPK6 0.0 570 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4TXQ7 0.0 569 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella schwarzengrund (strain CVM19633)
B4TK31 0.0 569 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella heidelberg (strain SL476)
B5FJ02 0.0 569 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella dublin (strain CT_02021853)
B5F8R6 0.0 569 62 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella agona (strain SL483)
C0Q5R6 0.0 567 62 0 437 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella paratyphi C (strain RKS4594)
Q57T52 0.0 567 62 0 437 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella choleraesuis (strain SC-B67)
Q8ZRP8 0.0 566 61 0 442 1 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z9B3 0.0 565 61 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella typhi
A8ALD3 0.0 563 60 0 451 3 clcA H(+)/Cl(-) exchange transporter ClcA Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5BL83 0.0 563 61 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella paratyphi A (strain AKU_12601)
Q5PD50 0.0 563 61 0 442 3 clcA H(+)/Cl(-) exchange transporter ClcA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5Y1L4 0.0 556 63 0 437 3 clcA H(+)/Cl(-) exchange transporter ClcA Klebsiella pneumoniae (strain 342)
A6T4V9 0.0 529 62 0 437 3 clcA H(+)/Cl(-) exchange transporter ClcA Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7MGR4 5.84e-179 512 60 2 461 3 clcA H(+)/Cl(-) exchange transporter ClcA Cronobacter sakazakii (strain ATCC BAA-894)
B2K549 3.3e-168 485 58 0 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pseudotuberculosis serotype IB (strain PB1/+)
B1JK21 1.06e-167 484 58 0 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TPW7 1.06e-167 484 58 0 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis (strain Pestoides F)
Q1CLU6 1.06e-167 484 58 0 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1E4 1.06e-167 484 58 0 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBM0 1.06e-167 484 58 0 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis
Q1C3X2 1.06e-167 484 58 0 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pestis bv. Antiqua (strain Antiqua)
A7FM08 1.3e-167 483 58 0 452 3 clcA H(+)/Cl(-) exchange transporter ClcA Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q32JV3 1.52e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella dysenteriae serotype 1 (strain Sd197)
B1LGV8 1.52e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain SMS-3-5 / SECEC)
Q0TLH6 1.52e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7MP17 1.52e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O81 (strain ED1a)
B7NIB8 1.52e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0D5 1.52e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O157:H7 (strain EC4115 / EHEC)
P58244 1.52e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O157:H7
Q1RG33 1.81e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain UTI89 / UPEC)
Q8FL15 1.81e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1A7K1 1.81e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O1:K1 / APEC
B7MBD8 1.81e-167 483 60 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3Z5K2 2.28e-167 483 59 0 434 1 clcA H(+)/Cl(-) exchange transporter ClcA Shigella sonnei (strain Ss046)
B6HZD1 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain SE11)
B7N824 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P37019 2.28e-167 483 59 0 434 1 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain K12)
B1IQI5 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XD25 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain K12 / DH10B)
C4ZRP8 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain K12 / MC4100 / BW2952)
B7M196 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O8 (strain IAI1)
B7LGL7 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli (strain 55989 / EAEC)
B7UIK2 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZHP7 2.28e-167 483 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O139:H28 (strain E24377A / ETEC)
A7ZWA3 4.73e-167 482 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia coli O9:H4 (strain HS)
Q325Y4 6.49e-167 481 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella boydii serotype 4 (strain Sb227)
B7LWB6 9.2e-167 481 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2U300 1.17e-165 478 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P59639 2.41e-163 472 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella flexneri
Q0T851 2.41e-163 472 59 0 434 3 clcA H(+)/Cl(-) exchange transporter ClcA Shigella flexneri serotype 5b (strain 8401)
A5F0D5 9.43e-157 455 54 2 469 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C3LVE3 9.74e-157 455 54 2 469 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio cholerae serotype O1 (strain M66-2)
Q9KM62 9.74e-157 455 54 2 469 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87GZ9 2.29e-151 442 54 2 462 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7N6K9 7.23e-139 410 53 3 464 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio campbellii (strain ATCC BAA-1116)
Q7MDF0 1.01e-137 407 55 1 436 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio vulnificus (strain YJ016)
Q8D6J0 1.01e-137 407 55 1 436 3 clcA H(+)/Cl(-) exchange transporter ClcA Vibrio vulnificus (strain CMCP6)
Q8XTT4 6.75e-34 135 31 4 326 3 RSp0020 Putative chloride channel protein ClcB-like Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8ZEB3 3.85e-28 119 32 9 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Yersinia pestis
A8AGW0 6.66e-28 118 28 4 317 3 clcB Voltage-gated ClC-type chloride channel ClcB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q9AGD5 7.19e-28 118 32 9 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FHW4 7.19e-28 118 32 9 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8RXR2 2.83e-23 106 31 9 315 2 CLC-F Chloride channel protein CLC-f Arabidopsis thaliana
Q8GX93 1.25e-20 98 28 9 322 2 CLC-E Chloride channel protein CLC-e Arabidopsis thaliana
B7NB42 4.04e-20 95 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A8A0D3 9.87e-20 94 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O9:H4 (strain HS)
P59638 1.02e-19 94 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Shigella flexneri
B7URT1 1.44e-19 94 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5Z428 1.53e-19 94 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X794 1.53e-19 94 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O157:H7
B1LEU5 1.74e-19 94 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain SMS-3-5 / SECEC)
B1IQZ8 1.86e-19 93 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7LZY4 1.86e-19 93 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O8 (strain IAI1)
B7L5E4 1.86e-19 93 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain 55989 / EAEC)
A7ZM51 1.86e-19 93 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O139:H28 (strain E24377A / ETEC)
P76175 1.87e-19 93 30 6 321 1 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain K12)
B1XF57 1.87e-19 93 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain K12 / DH10B)
C4ZY54 1.87e-19 93 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli (strain K12 / MC4100 / BW2952)
P92942 6.5e-19 93 23 14 461 1 CLC-B Chloride channel protein CLC-b Arabidopsis thaliana
B2U1Q2 9.56e-19 91 31 7 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8FHC1 1.15e-18 91 29 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7MV39 1.15e-18 91 29 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O81 (strain ED1a)
B7NUP7 1.37e-18 91 30 6 321 3 clcB Voltage-gated ClC-type chloride channel ClcB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P92941 2.23e-18 91 24 16 453 1 CLC-A Chloride channel protein CLC-a Arabidopsis thaliana
P51793 1.93e-17 89 22 17 548 1 CLCN4 H(+)/Cl(-) exchange transporter 4 Homo sapiens
P51794 8.51e-17 86 22 17 548 2 Clcn4 H(+)/Cl(-) exchange transporter 4 Rattus norvegicus
P0C197 1.45e-16 86 27 12 383 3 UMAG_11084 Probable chloride channel protein UM03490-D Ustilago maydis (strain 521 / FGSC 9021)
P51796 2.23e-16 85 25 16 434 2 Clcn5 H(+)/Cl(-) exchange transporter 5 Rattus norvegicus
Q9WVD4 2.42e-16 85 25 17 450 1 Clcn5 H(+)/Cl(-) exchange transporter 5 Mus musculus
Q61418 3.79e-16 84 24 14 447 2 Clcn4 H(+)/Cl(-) exchange transporter 4 Mus musculus
Q8ZPK5 4.63e-16 83 29 6 319 3 clcB Voltage-gated ClC-type chloride channel ClcB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5FHR3 6.37e-16 83 29 6 319 3 clcB Voltage-gated ClC-type chloride channel ClcB Salmonella dublin (strain CT_02021853)
P51795 1.01e-15 83 25 14 431 1 CLCN5 H(+)/Cl(-) exchange transporter 5 Homo sapiens
Q5RBK4 1.03e-15 83 25 14 431 2 CLCN5 H(+)/Cl(-) exchange transporter 5 Pongo abelii
Q9GKE7 1.08e-15 83 25 14 430 2 CLCN5 H(+)/Cl(-) exchange transporter 5 Sus scrofa
Q99P66 2.84e-15 82 23 14 446 2 CLCN5 H(+)/Cl(-) exchange transporter 5 Cavia porcellus
Q8Z6Y0 3.3e-15 80 28 6 319 3 clcB Voltage-gated ClC-type chloride channel ClcB Salmonella typhi
Q86AZ6 3.64e-15 81 22 13 512 3 clcB Chloride channel protein B Dictyostelium discoideum
Q96282 6.31e-15 80 24 10 405 1 CLC-C Chloride channel protein CLC-c Arabidopsis thaliana
Q9TTU3 6.83e-15 80 24 14 430 2 CLCN5 H(+)/Cl(-) exchange transporter 5 Oryctolagus cuniculus
O60159 1.85e-14 79 26 12 397 3 SPBC19C7.11 Putative anion/proton exchange transporter C19C7.11 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9R279 2.36e-14 79 23 15 433 2 CLCN3 H(+)/Cl(-) exchange transporter 3 Cavia porcellus
Q54C67 2.87e-14 79 21 17 484 3 clcF Chloride channel protein F Dictyostelium discoideum
P51791 3.35e-14 79 23 15 433 1 Clcn3 H(+)/Cl(-) exchange transporter 3 Mus musculus
O18894 3.38e-14 79 23 15 433 2 CLCN3 H(+)/Cl(-) exchange transporter 3 Oryctolagus cuniculus
P51790 3.38e-14 79 23 15 433 1 CLCN3 H(+)/Cl(-) exchange transporter 3 Homo sapiens
P51792 3.86e-14 78 23 15 433 2 Clcn3 H(+)/Cl(-) exchange transporter 3 Rattus norvegicus
P21564 4.04e-14 78 25 11 395 1 None Chloride channel protein Torpedo marmorata
Q57753 6.59e-14 76 24 10 377 3 MJ0305 Uncharacterized protein MJ0305 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P35522 3.3e-13 75 25 12 395 1 None Chloride channel protein Tetronarce californica
P60300 1.09e-12 73 24 11 383 1 CLC-G Putative chloride channel-like protein CLC-g Arabidopsis thaliana
Q54LQ4 1.59e-12 73 22 11 428 3 clcE Chloride channel protein E Dictyostelium discoideum
Q5RDJ7 3.46e-12 72 23 15 424 2 CLCN3 H(+)/Cl(-) exchange transporter 3 Pongo abelii
P37020 7.25e-12 71 23 14 482 1 GEF1 Anion/proton exchange transporter GEF1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P92943 7.92e-12 71 36 4 160 1 CLC-D Chloride channel protein CLC-d Arabidopsis thaliana
P92943 3.2e-05 50 24 0 91 1 CLC-D Chloride channel protein CLC-d Arabidopsis thaliana
O94287 1.13e-11 70 24 12 386 3 SPBC887.02 Uncharacterized chloride channel protein C887.02 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q75JF3 1.79e-10 67 27 5 218 3 clcC Chloride channel protein C Dictyostelium discoideum
Q75JF3 6.04e-05 49 26 3 127 3 clcC Chloride channel protein C Dictyostelium discoideum
P51799 2.01e-10 67 22 15 507 2 Clcn7 H(+)/Cl(-) exchange transporter 7 Rattus norvegicus
O70496 2.59e-10 66 22 15 507 1 Clcn7 H(+)/Cl(-) exchange transporter 7 Mus musculus
Q9VGH7 6.33e-10 65 23 19 454 2 ClC-a Chloride channel protein 2 Drosophila melanogaster
Q87WD2 7.11e-09 61 23 12 354 1 eriC Chloride/fluoride channel protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P51804 3.81e-08 59 25 11 276 2 CLCNKB Chloride channel protein ClC-Kb Oryctolagus cuniculus
P51803 4.22e-08 59 25 11 276 2 CLCNKA Chloride channel protein ClC-Ka Oryctolagus cuniculus
Q9W701 6.53e-08 58 28 10 193 1 clcnkb Chloride channel protein ClC-Kb Xenopus laevis
Q4VFY6 1.39e-07 57 26 14 370 3 sycA Symbiosis-assisting ClC homolog Rhizobium tropici
Q1ZXJ0 3.74e-07 56 28 3 183 3 clcD Chloride channel protein D Dictyostelium discoideum
P51789 7.77e-07 55 23 15 401 2 CLCN2 Chloride channel protein 2 Oryctolagus cuniculus
P35523 1.03e-06 55 33 2 115 1 CLCN1 Chloride channel protein 1 Homo sapiens
P35523 0.000354 47 27 3 139 1 CLCN1 Chloride channel protein 1 Homo sapiens
P51798 1.22e-06 54 22 14 506 1 CLCN7 H(+)/Cl(-) exchange transporter 7 Homo sapiens
P35524 1.25e-06 54 33 2 115 1 Clcn1 Chloride channel protein 1 Rattus norvegicus
P35524 0.00017 48 29 4 139 1 Clcn1 Chloride channel protein 1 Rattus norvegicus
Q64347 1.28e-06 54 33 2 115 1 Clcn1 Chloride channel protein 1 Mus musculus
Q64347 0.000159 48 29 4 139 1 Clcn1 Chloride channel protein 1 Mus musculus
Q9TT16 2.16e-06 53 23 15 422 2 CLCN6 H(+)/Cl(-) exchange transporter 6 Oryctolagus cuniculus
Q9BMK9 3.22e-06 53 29 4 131 1 clh-3 Chloride channel protein clh-3 Caenorhabditis elegans
Q54AX6 3.78e-06 53 27 4 208 2 clcA Chloride channel protein A Dictyostelium discoideum
O35454 5.54e-06 52 29 3 126 1 Clcn6 H(+)/Cl(-) exchange transporter 6 Mus musculus
Q4PKH3 5.56e-06 52 21 14 506 2 CLCN7 H(+)/Cl(-) exchange transporter 7 Bos taurus
Q9WU45 1.44e-05 51 32 3 109 1 CLCN2 Chloride channel protein 2 Cavia porcellus
Q9R0A1 1.95e-05 50 32 3 109 1 Clcn2 Chloride channel protein 2 Mus musculus
P35525 2.07e-05 50 32 3 109 1 Clcn2 Chloride channel protein 2 Rattus norvegicus
P51788 2.7e-05 50 32 3 109 1 CLCN2 Chloride channel protein 2 Homo sapiens
P51797 3.94e-05 50 30 2 111 1 CLCN6 H(+)/Cl(-) exchange transporter 6 Homo sapiens
Q9MZT1 0.000123 48 33 2 104 1 CLCN1 Chloride channel protein 1 Canis lupus familiaris
Q9MZT1 0.000516 46 28 4 139 1 CLCN1 Chloride channel protein 1 Canis lupus familiaris
P51800 0.000638 46 26 14 273 1 CLCNKA Chloride channel protein ClC-Ka Homo sapiens

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS10420
Feature type CDS
Gene clcA
Product H(+)/Cl(-) exchange transporter ClcA
Location 2289051 - 2290451 (strand: 1)
Length 1401 (nucleotides) / 466 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2683
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF00654 Voltage gated chloride channel

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0038 Inorganic ion transport and metabolism (P) P H+/Cl- antiporter ClcA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03281 chloride channel protein, CIC family - -

Protein Sequence

MYQRNTIKKSQNQQRFNWFRKAKETNLAPVKTLILSAIIGTLAGLIGVLFEKAVGWVIHLRQDKLAEVLTNPYLLAIGTLLVSSLLAMSGYYLVKKFSPESGGSGIPEIEGAMIDIRPVRWWRVLPVKFIASIGTLGSGMVLGREGPTVQLGANIGQLINDVSRVKDKGTRQTLLATGAAAGLTAAFNAPLAGILFIIEEMRPQFKYNLISIKSVFIGVIMSCIVFRLINGEGGVIQIGKFSSAPMNTLWLYLVLGMLFGVVGVIFSKLLFYVQTQFQHFYQDKTSRFVLAGGVIGGACGLLALIIPEITGGGFSIIPALSAGGYSLTALLIFFVLRTITTIISFSSGAPGGIFAPTLALGTLFGSAFGLMATYLFPDYQIQIGTFAIAGMGALFAATVRAPLTGIVLVLEMTDNYQLILPMIITCLGATMLAQLLGGRPIYTVLLERILQRSEAKEKTEAPKEPL

Flanking regions ( +/- flanking 50bp)

AAATTACGCTATTATTAGATACATTGTTATTTATATATAAAACATAAATTATGTATCAGCGAAACACGATCAAAAAATCGCAAAATCAACAACGCTTTAATTGGTTTAGAAAAGCGAAAGAAACTAACCTTGCCCCGGTGAAAACGCTTATTCTTTCCGCCATTATCGGTACGTTAGCCGGATTAATTGGGGTACTATTTGAAAAAGCCGTTGGCTGGGTCATTCATTTAAGACAAGATAAATTAGCCGAGGTATTAACCAACCCTTATCTTTTGGCTATTGGCACGTTACTTGTTTCCTCTCTTTTAGCCATGAGTGGCTACTACTTAGTGAAGAAGTTTTCACCAGAATCTGGTGGTTCAGGTATACCGGAAATCGAAGGGGCAATGATAGATATTCGGCCAGTTCGTTGGTGGCGGGTATTGCCAGTAAAATTTATAGCCAGTATCGGTACCTTAGGCTCAGGTATGGTACTTGGTCGTGAAGGCCCCACCGTGCAACTAGGGGCTAATATTGGTCAACTCATTAATGATGTCTCTCGCGTTAAAGATAAAGGAACGCGCCAAACACTATTAGCCACAGGGGCTGCTGCCGGTTTAACGGCTGCCTTTAATGCTCCCTTGGCAGGCATTCTATTTATTATTGAAGAGATGAGACCACAATTTAAATATAATCTTATCTCTATTAAATCCGTCTTCATTGGCGTGATCATGTCTTGTATTGTATTTCGCCTAATTAATGGTGAAGGAGGCGTCATACAGATAGGTAAATTTTCTTCAGCGCCGATGAATACACTGTGGCTCTATTTAGTGTTAGGAATGTTATTTGGTGTTGTTGGGGTTATTTTTAGTAAATTACTGTTTTATGTTCAAACACAATTCCAACATTTTTATCAAGATAAAACCTCACGTTTTGTTTTAGCCGGTGGCGTGATTGGTGGTGCATGTGGTTTACTTGCGTTGATTATTCCTGAAATAACCGGAGGCGGTTTTAGTATTATTCCTGCATTAAGTGCCGGAGGATATTCGTTAACTGCACTGCTAATATTTTTTGTGTTACGTACCATCACCACCATTATCAGCTTCTCCTCCGGTGCACCAGGAGGAATTTTTGCCCCCACATTAGCCTTAGGCACACTCTTTGGTAGCGCTTTTGGATTAATGGCAACCTATCTTTTCCCTGATTATCAAATTCAAATTGGCACTTTTGCTATTGCTGGAATGGGTGCTTTATTTGCCGCAACGGTGAGAGCACCACTAACTGGGATTGTGTTAGTTCTAGAAATGACCGATAACTATCAACTTATTTTGCCAATGATAATTACCTGTCTTGGCGCAACCATGCTGGCGCAATTATTAGGCGGGCGACCTATTTATACGGTTCTACTCGAAAGAATACTACAACGCTCAGAAGCCAAAGAAAAAACAGAGGCTCCCAAAGAGCCCCTATAGTTTTCAAATACTAAAATACCCTCGCTGTGATCTAACGAGGGTATTTTTCT