Homologs in group_889

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04120 FBDBKF_04120 100.0 Morganella morganii S1 ygfZ tRNA-modifying protein YgfZ
NLDBIP_05730 NLDBIP_05730 100.0 Morganella morganii S4 ygfZ tRNA-modifying protein YgfZ
LHKJJB_02610 LHKJJB_02610 100.0 Morganella morganii S3 ygfZ tRNA-modifying protein YgfZ
HKOGLL_06085 HKOGLL_06085 100.0 Morganella morganii S5 ygfZ tRNA-modifying protein YgfZ
F4V73_RS08560 F4V73_RS08560 79.8 Morganella psychrotolerans ygfZ tRNA-modifying protein YgfZ
PMI_RS09945 PMI_RS09945 54.0 Proteus mirabilis HI4320 ygfZ tRNA-modifying protein YgfZ

Distribution of the homologs in the orthogroup group_889

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_889

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N1C0 8.82e-142 406 59 0 318 3 plu3556 tRNA-modifying protein YgfZ Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GIQ4 8.54e-137 394 61 3 321 3 Spro_3899 tRNA-modifying protein YgfZ Serratia proteamaculans (strain 568)
A7MR73 2.69e-132 382 60 4 320 3 ESA_00433 tRNA-modifying protein YgfZ Cronobacter sakazakii (strain ATCC BAA-894)
A1JPM8 1.52e-130 378 59 2 316 3 YE3387 tRNA-modifying protein YgfZ Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6D8Y4 1.09e-128 373 58 3 320 3 PC1_0637 tRNA-modifying protein YgfZ Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q666S2 8.02e-128 371 58 3 319 3 YPTB3174 tRNA-modifying protein YgfZ Yersinia pseudotuberculosis serotype I (strain IP32953)
A7FF28 8.02e-128 371 58 3 319 3 YpsIP31758_0872 tRNA-modifying protein YgfZ Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1JNT4 5.3e-127 369 58 3 319 3 YPK_0875 tRNA-modifying protein YgfZ Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TIB4 5.3e-127 369 58 3 319 3 YPDSF_0617 tRNA-modifying protein YgfZ Yersinia pestis (strain Pestoides F)
Q1CF05 5.3e-127 369 58 3 319 3 YPN_3098 tRNA-modifying protein YgfZ Yersinia pestis bv. Antiqua (strain Nepal516)
A9R4L4 5.3e-127 369 58 3 319 3 YpAngola_A3840 tRNA-modifying protein YgfZ Yersinia pestis bv. Antiqua (strain Angola)
Q7CGT3 5.3e-127 369 58 3 319 3 YPO0898 tRNA-modifying protein YgfZ Yersinia pestis
Q1CB34 5.3e-127 369 58 3 319 3 YPA_0370 tRNA-modifying protein YgfZ Yersinia pestis bv. Antiqua (strain Antiqua)
B5FUG1 1.14e-126 368 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella dublin (strain CT_02021853)
Q8ZM80 1.55e-126 367 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B2K0P7 2.5e-126 367 57 3 319 3 YPTS_3305 tRNA-modifying protein YgfZ Yersinia pseudotuberculosis serotype IB (strain PB1/+)
C0PY21 6.29e-126 366 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella paratyphi C (strain RKS4594)
Q57K67 6.29e-126 366 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella choleraesuis (strain SC-B67)
A4WE49 1.02e-125 365 58 3 318 3 Ent638_3316 tRNA-modifying protein YgfZ Enterobacter sp. (strain 638)
B5BFL3 1.81e-125 365 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella paratyphi A (strain AKU_12601)
A9N3M5 1.81e-125 365 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJF4 1.81e-125 365 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T543 1.81e-125 365 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella newport (strain SL254)
B4TGW8 1.81e-125 365 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella heidelberg (strain SL476)
B5RE09 1.81e-125 365 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXH5 1.81e-125 365 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella enteritidis PT4 (strain P125109)
B5F5H2 1.81e-125 365 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella agona (strain SL483)
Q8Z3X4 5.06e-125 363 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella typhi
B4TUR5 5.06e-125 363 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella schwarzengrund (strain CVM19633)
B5YQ91 8.19e-125 363 59 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XD41 8.19e-125 363 59 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O157:H7
Q3YXX2 2.87e-124 362 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Shigella sonnei (strain Ss046)
B1ITA4 2.91e-124 362 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7NW39 4.75e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O7:K1 (strain IAI39 / ExPEC)
A9MRH6 5.41e-124 361 57 3 318 3 ygfZ tRNA-modifying protein YgfZ Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
P0ADE9 5.78e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Shigella flexneri
Q0T0Z9 5.78e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Shigella flexneri serotype 5b (strain 8401)
P0ADE8 5.78e-124 361 58 3 318 1 ygfZ tRNA-modifying protein YgfZ Escherichia coli (strain K12)
A8A439 5.78e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O9:H4 (strain HS)
B1XEI5 5.78e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli (strain K12 / DH10B)
C5A0H0 5.78e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYG2 5.78e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O8 (strain IAI1)
B7LF83 5.78e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli (strain 55989 / EAEC)
A7ZR07 5.78e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O139:H28 (strain E24377A / ETEC)
B7N7E2 5.91e-124 361 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1LD99 1.24e-123 360 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli (strain SMS-3-5 / SECEC)
Q31WG0 1.61e-123 360 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Shigella boydii serotype 4 (strain Sb227)
Q0TDV3 1.84e-123 360 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7LPB2 2.05e-123 360 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R7D2 3.39e-123 359 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli (strain UTI89 / UPEC)
A1AF88 3.39e-123 359 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O1:K1 / APEC
B7MZ51 3.39e-123 359 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O81 (strain ED1a)
B7MM85 3.39e-123 359 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UHU7 5.54e-123 358 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B6I731 8.03e-123 358 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli (strain SE11)
Q6D961 8.37e-123 358 55 3 321 3 ECA0758 tRNA-modifying protein YgfZ Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B2U0R5 1.14e-122 358 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q8FE70 1.39e-122 357 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B5XUE6 2.82e-122 357 58 3 318 3 KPK_0772 tRNA-modifying protein YgfZ Klebsiella pneumoniae (strain 342)
Q32BW1 3.87e-122 356 58 3 318 3 ygfZ tRNA-modifying protein YgfZ Shigella dysenteriae serotype 1 (strain Sd197)
Q2NRF3 4.98e-116 341 55 3 321 3 SG1997 tRNA-modifying protein YgfZ Sodalis glossinidius (strain morsitans)
C5BAS5 1.9e-108 322 49 3 329 3 NT01EI_3346 tRNA-modifying protein YgfZ Edwardsiella ictaluri (strain 93-146)
C4K7V2 1.29e-93 284 46 3 309 3 HDEF_2079 tRNA-modifying protein YgfZ Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B6EKN9 9.16e-80 248 43 8 327 3 VSAL_I2535 tRNA-modifying protein YgfZ Aliivibrio salmonicida (strain LFI1238)
Q5E304 1.11e-79 248 43 8 327 3 VF_2097 tRNA-modifying protein YgfZ Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1LTU6 4.45e-79 247 37 3 317 3 BCI_0149 tRNA-modifying protein YgfZ Baumannia cicadellinicola subsp. Homalodisca coagulata
B5FAI0 4.15e-78 244 42 8 327 3 VFMJ11_2202 tRNA-modifying protein YgfZ Aliivibrio fischeri (strain MJ11)
Q6LMR1 2.48e-77 242 42 7 320 3 PBPRA3100 tRNA-modifying protein YgfZ Photobacterium profundum (strain SS9)
A7MTS4 1.74e-73 232 40 6 327 3 VIBHAR_03546 tRNA-modifying protein YgfZ Vibrio campbellii (strain ATCC BAA-1116)
Q8K9C6 3.78e-73 231 37 4 306 3 BUsg_420 tRNA-modifying protein YgfZ Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A5F5F3 1.43e-71 228 41 8 321 3 VC0395_A2049 tRNA-modifying protein YgfZ Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P57510 1.52e-71 227 36 3 308 3 BU435 tRNA-modifying protein YgfZ Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q47WN5 1.99e-71 227 38 6 328 3 CPS_4132 tRNA-modifying protein YgfZ Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
C3LR15 6.77e-71 226 41 8 321 3 VCM66_2395 tRNA-modifying protein YgfZ Vibrio cholerae serotype O1 (strain M66-2)
Q9KPA1 6.77e-71 226 41 8 321 3 VC_2472 tRNA-modifying protein YgfZ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87LM8 7.81e-71 226 39 8 331 3 VP2583 tRNA-modifying protein YgfZ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q493E3 1.31e-70 225 39 6 307 3 BPEN_268 tRNA-modifying protein YgfZ Blochmanniella pennsylvanica (strain BPEN)
Q8DC85 1.25e-69 223 42 6 319 3 VV1_1556 tRNA-modifying protein YgfZ Vibrio vulnificus (strain CMCP6)
Q7MHM7 9.09e-69 220 41 6 319 3 VV2842 tRNA-modifying protein YgfZ Vibrio vulnificus (strain YJ016)
Q89AC3 2.21e-67 216 35 5 315 3 bbp_391 tRNA-modifying protein YgfZ Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
B7VK90 6.45e-65 210 38 7 318 3 VS_2630 tRNA-modifying protein YgfZ Vibrio atlanticus (strain LGP32)
P44000 4.73e-60 196 38 8 309 4 HI_0466 Uncharacterized protein HI_0466 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VRF7 4.17e-58 193 34 7 318 3 Bfl260 tRNA-modifying protein YgfZ Blochmanniella floridana
Q7RYZ1 7.49e-09 60 24 9 258 3 caf-17 Putative transferase caf-17, mitochondrial Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
A4R8F9 3.22e-08 58 25 7 234 3 CAF17 Putative transferase CAF17, mitochondrial Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
Q2H6N9 6e-08 57 23 10 254 3 CAF17 Putative transferase CAF17, mitochondrial Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970)
B8JMH0 6.19e-08 57 25 8 228 3 iba57 Putative transferase CAF17 homolog, mitochondrial Danio rerio
Q0UE25 6.76e-05 47 23 7 240 3 CAF17 Putative transferase CAF17, mitochondrial Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_05410
Feature type CDS
Gene ygfZ
Product tRNA-modifying protein YgfZ
Location 67939 - 68922 (strand: 1)
Length 984 (nucleotides) / 327 (amino acids)
In genomic island GI94

Contig

Accession ZDB_215
Length 284267 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_889
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01571 Aminomethyltransferase folate-binding domain
PF21130 YgfZ, beta-barrel domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0354 Posttranslational modification, protein turnover, chaperones (O) O Folate-binding protein YgfZ, synthesis and repair of Fe-S clusters

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06980 tRNA-modifying protein YgfZ - -

Protein Sequence

MNTETNTLLPQLSDSLPLTRISLSDLALVTITGPDSQKYLQGQVTADIDAMADDQHVLCAHCDAKGKMWSDLRLFHYKDGYAYLIRRSALDTQLAELKKYAVFSKVTIAADDSAVLTGIAGHGAAEALQAHFSTVPDADTQVVSSDDTTLLYLPLPQGRFILIQTAEQAGALSDALSLPDASDTQWTALDIEAGYAVIDAATVGEFLPQATNLQSLPRGICFKKGCYTGQEMVARAKFRGANKRAMFTLIGHSRHVPVAGDDAERQLGENWRRTGTILAAVRLSDDRVLVQIVMNNDTEEDAVFRIREDEESRLSLFPLPYSFTEEA

Flanking regions ( +/- flanking 50bp)

GTTATCTCTTTTACCATACATTGCACAGCTCTCCGGACAGGTAAAACATCATGAACACAGAAACAAATACATTACTCCCGCAACTGAGTGATTCTCTCCCCCTGACACGCATTTCCCTCAGCGATCTGGCGCTGGTGACCATCACCGGCCCGGATAGTCAGAAGTATCTTCAGGGACAGGTCACCGCTGATATCGACGCTATGGCTGATGATCAGCATGTGCTGTGTGCCCATTGTGATGCCAAAGGGAAGATGTGGAGTGATCTGCGTCTGTTTCATTATAAAGACGGTTACGCCTACCTTATCCGCCGCAGTGCGCTGGATACCCAGCTCGCGGAACTGAAAAAATACGCGGTATTTTCCAAAGTGACGATTGCCGCTGATGATAGTGCTGTCCTGACCGGGATCGCCGGTCACGGTGCGGCAGAAGCCTTACAGGCACATTTCAGCACAGTTCCGGATGCGGACACTCAGGTTGTCAGCAGCGATGACACCACGCTGCTGTATCTGCCGCTGCCGCAGGGGCGTTTTATTCTGATCCAAACCGCTGAACAGGCCGGTGCTTTATCTGATGCCCTGTCTCTGCCGGACGCGTCTGACACTCAGTGGACCGCACTGGATATTGAAGCTGGTTACGCCGTAATTGATGCGGCAACCGTCGGTGAATTTCTGCCGCAGGCAACAAATCTGCAATCCCTTCCCCGGGGTATCTGCTTTAAGAAAGGCTGTTATACCGGCCAGGAAATGGTCGCCCGCGCCAAATTCCGCGGTGCCAACAAACGCGCGATGTTCACGCTTATCGGCCACAGCCGCCATGTGCCGGTCGCCGGTGATGATGCTGAGCGTCAGCTGGGTGAAAACTGGCGCCGCACCGGTACCATTCTCGCGGCTGTCCGCCTGAGCGATGACCGCGTTCTGGTGCAGATTGTGATGAATAATGATACGGAGGAAGATGCTGTCTTCCGTATCCGTGAAGATGAAGAAAGCCGCCTGAGCCTTTTCCCGCTGCCGTACTCCTTTACTGAAGAAGCCTGATTTCCCGTCATCCCCGGGCGCAGAGATACCCTGTCTCTGCGCCCGGAGGT