Homologs in group_1486

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09585 FBDBKF_09585 100.0 Morganella morganii S1 moaA GTP 3',8-cyclase MoaA
NLDBIP_04385 NLDBIP_04385 100.0 Morganella morganii S4 moaA GTP 3',8-cyclase MoaA
LHKJJB_14245 LHKJJB_14245 100.0 Morganella morganii S3 moaA GTP 3',8-cyclase MoaA
HKOGLL_12290 HKOGLL_12290 100.0 Morganella morganii S5 moaA GTP 3',8-cyclase MoaA
F4V73_RS00760 F4V73_RS00760 94.5 Morganella psychrotolerans moaA GTP 3',8-cyclase MoaA
PMI_RS03005 PMI_RS03005 80.1 Proteus mirabilis HI4320 moaA GTP 3',8-cyclase MoaA

Distribution of the homologs in the orthogroup group_1486

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1486

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N6P6 0.0 552 79 0 327 3 moaA GTP 3',8-cyclase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ZGW5 0.0 537 78 0 324 3 moaA GTP 3',8-cyclase Yersinia pestis
A7MJ10 0.0 523 75 1 329 3 moaA GTP 3',8-cyclase Cronobacter sakazakii (strain ATCC BAA-894)
C5B7H2 0.0 514 74 1 329 3 moaA GTP 3',8-cyclase Edwardsiella ictaluri (strain 93-146)
Q32I50 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Shigella dysenteriae serotype 1 (strain Sd197)
A7ZY37 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O9:H4 (strain HS)
Q324B1 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Shigella boydii serotype 4 (strain Sb227)
B1LM72 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli (strain SMS-3-5 / SECEC)
B6I7T6 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli (strain SE11)
P65382 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7M753 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O8 (strain IAI1)
B7MQN5 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O81 (strain ED1a)
B5YRM0 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O157:H7 (strain EC4115 / EHEC)
P65383 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O157:H7
B7LC63 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli (strain 55989 / EAEC)
A7ZJJ0 0.0 509 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O139:H28 (strain E24377A / ETEC)
P30745 0.0 508 72 1 329 1 moaA GTP 3',8-cyclase Escherichia coli (strain K12)
B1X7B1 0.0 508 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli (strain K12 / DH10B)
C4ZXV3 0.0 508 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli (strain K12 / MC4100 / BW2952)
B7NA81 0.0 508 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B7ULX8 0.0 508 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q3Z403 0.0 507 72 1 329 3 moaA GTP 3',8-cyclase Shigella sonnei (strain Ss046)
Q83S40 0.0 507 72 1 329 3 moaA GTP 3',8-cyclase Shigella flexneri
B2TVE9 0.0 506 72 1 329 3 moaA GTP 3',8-cyclase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LJY1 0.0 506 72 1 329 3 moaA GTP 3',8-cyclase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B7MGN9 0.0 506 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NNL1 0.0 505 72 1 329 3 moaA GTP 3',8-cyclase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
C0PWZ0 7.36e-180 503 72 1 329 3 moaA GTP 3',8-cyclase Salmonella paratyphi C (strain RKS4594)
P65386 1.89e-179 502 72 1 329 3 moaA GTP 3',8-cyclase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65387 1.89e-179 502 72 1 329 3 moaA GTP 3',8-cyclase Salmonella typhi
B4TQU6 1.89e-179 502 72 1 329 3 moaA GTP 3',8-cyclase Salmonella schwarzengrund (strain CVM19633)
B5BC24 1.89e-179 502 72 1 329 3 moaA GTP 3',8-cyclase Salmonella paratyphi A (strain AKU_12601)
Q5PG37 1.89e-179 502 72 1 329 3 moaA GTP 3',8-cyclase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZK4 1.89e-179 502 72 1 329 3 moaA GTP 3',8-cyclase Salmonella newport (strain SL254)
B5F079 1.89e-179 502 72 1 329 3 moaA GTP 3',8-cyclase Salmonella agona (strain SL483)
B5R769 2.27e-179 501 72 1 329 3 moaA GTP 3',8-cyclase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QX73 2.27e-179 501 72 1 329 3 moaA GTP 3',8-cyclase Salmonella enteritidis PT4 (strain P125109)
B5FP68 2.27e-179 501 72 1 329 3 moaA GTP 3',8-cyclase Salmonella dublin (strain CT_02021853)
B5XYW6 2.27e-179 501 72 1 329 3 moaA GTP 3',8-cyclase Klebsiella pneumoniae (strain 342)
Q6D3C7 2.93e-179 501 75 1 329 3 moaA GTP 3',8-cyclase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A9MTH7 3.12e-179 501 72 1 329 3 moaA GTP 3',8-cyclase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A6T6M5 6.73e-179 500 72 1 329 3 moaA GTP 3',8-cyclase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4TC55 2.82e-178 499 71 1 329 3 moaA GTP 3',8-cyclase Salmonella heidelberg (strain SL476)
Q87MY0 6e-165 465 64 1 329 3 moaA GTP 3',8-cyclase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8D894 8.8e-162 457 63 1 329 3 moaA GTP 3',8-cyclase Vibrio vulnificus (strain CMCP6)
Q7MM75 4.35e-161 456 63 1 329 3 moaA GTP 3',8-cyclase Vibrio vulnificus (strain YJ016)
B7VLU4 1.71e-160 454 63 1 329 3 moaA GTP 3',8-cyclase Vibrio atlanticus (strain LGP32)
C3LTS1 6.32e-159 450 64 1 329 3 moaA GTP 3',8-cyclase Vibrio cholerae serotype O1 (strain M66-2)
Q9KT81 6.32e-159 450 64 1 329 3 moaA GTP 3',8-cyclase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2Q5 6.32e-159 450 64 1 329 3 moaA GTP 3',8-cyclase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A3N054 9.07e-158 447 64 1 325 3 moaA GTP 3',8-cyclase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3GXC5 3.64e-157 446 64 1 325 3 moaA GTP 3',8-cyclase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BNX2 5.7e-157 445 64 1 325 3 moaA GTP 3',8-cyclase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q65TT2 2.22e-156 444 62 1 327 3 moaA GTP 3',8-cyclase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P45311 1.74e-153 436 61 1 325 3 moaA GTP 3',8-cyclase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UBK4 4.66e-153 435 62 1 325 3 moaA GTP 3',8-cyclase Haemophilus influenzae (strain PittEE)
Q4QJR9 1.81e-152 434 61 1 325 3 moaA GTP 3',8-cyclase Haemophilus influenzae (strain 86-028NP)
A5UFB4 2.33e-152 434 61 1 325 3 moaA GTP 3',8-cyclase Haemophilus influenzae (strain PittGG)
C4LFK3 2.82e-150 428 60 0 323 3 moaA GTP 3',8-cyclase Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6VPY2 3.12e-150 428 61 1 326 3 moaA GTP 3',8-cyclase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q9CN21 5.55e-149 425 60 1 326 3 moaA GTP 3',8-cyclase Pasteurella multocida (strain Pm70)
A0KIL8 1.83e-145 416 59 1 328 3 moaA GTP 3',8-cyclase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7VLN1 3.69e-144 413 61 1 324 3 moaA GTP 3',8-cyclase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A1SWQ3 3.69e-141 405 56 0 327 3 moaA GTP 3',8-cyclase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q12T28 3.96e-135 390 56 0 325 3 moaA GTP 3',8-cyclase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B4SL67 2.67e-117 344 50 2 326 3 moaA GTP 3',8-cyclase Stenotrophomonas maltophilia (strain R551-3)
B2FUM0 3.7e-116 341 49 0 325 3 moaA GTP 3',8-cyclase Stenotrophomonas maltophilia (strain K279a)
Q56211 1.48e-100 301 45 1 324 3 moaA GTP 3',8-cyclase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q5N5F7 1.67e-100 301 45 1 324 3 moaA GTP 3',8-cyclase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
A1U578 1.12e-68 220 39 5 329 3 moaA GTP 3',8-cyclase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q31JB9 1.42e-67 218 37 5 314 3 moaA GTP 3',8-cyclase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A4J6S5 7.39e-67 215 38 3 318 3 moaA GTP 3',8-cyclase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A9BF51 3e-65 211 33 3 326 3 moaA GTP 3',8-cyclase Petrotoga mobilis (strain DSM 10674 / SJ95)
Q5RKZ7 1.87e-64 218 39 4 309 1 Mocs1 Molybdenum cofactor biosynthesis protein 1 Mus musculus
Q9NZB8 3.22e-64 217 37 3 308 1 MOCS1 Molybdenum cofactor biosynthesis protein 1 Homo sapiens
B0TI16 3.6e-64 209 37 3 327 3 moaA GTP 3',8-cyclase Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
Q1JQD7 3.76e-64 216 37 1 306 2 MOCS1 Molybdenum cofactor biosynthesis protein 1 Bos taurus
Q3ADX8 4.66e-64 208 35 3 325 3 moaA GTP 3',8-cyclase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q9I3K7 2.12e-63 207 37 5 328 3 moaA2 GTP 3',8-cyclase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A4XW05 1.03e-62 205 36 3 329 3 moaA GTP 3',8-cyclase Pseudomonas mendocina (strain ymp)
C6C060 2.03e-62 204 35 5 329 3 moaA GTP 3',8-cyclase Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A6TVF9 4.64e-61 200 34 5 325 3 moaA GTP 3',8-cyclase Alkaliphilus metalliredigens (strain QYMF)
A8MLW5 1.11e-60 199 35 3 308 3 moaA GTP 3',8-cyclase Alkaliphilus oremlandii (strain OhILAs)
Q89NT2 1.16e-60 200 34 4 334 3 moaA GTP 3',8-cyclase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A0L7R4 1.23e-60 199 36 3 317 3 moaA GTP 3',8-cyclase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q1QN98 5.01e-60 198 34 4 332 3 moaA GTP 3',8-cyclase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A0AHG0 5.85e-60 198 35 3 308 3 moaA GTP 3',8-cyclase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B5YJ09 9.04e-60 197 36 5 329 3 moaA GTP 3',8-cyclase Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q21I62 9.26e-60 197 36 2 307 3 moaA GTP 3',8-cyclase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8Y870 1.1e-59 197 35 3 308 3 moaA GTP 3',8-cyclase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B2GCN4 1.23e-59 197 36 5 310 3 moaA GTP 3',8-cyclase Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q93KD1 1.56e-59 196 34 5 326 3 moaA GTP 3',8-cyclase Peptoclostridium acidaminophilum
C1L1W8 1.69e-59 197 35 3 308 3 moaA GTP 3',8-cyclase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q139F2 1.69e-59 197 35 2 308 3 moaA GTP 3',8-cyclase Rhodopseudomonas palustris (strain BisB5)
Q721B9 1.71e-59 197 35 3 308 3 moaA GTP 3',8-cyclase Listeria monocytogenes serotype 4b (strain F2365)
Q3STB0 1.89e-59 197 33 4 332 3 moaA GTP 3',8-cyclase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q92CY2 3.59e-59 196 35 3 308 3 moaA GTP 3',8-cyclase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q20624 4.17e-59 202 36 4 307 3 moc-5 Molybdenum cofactor biosynthesis protein moc-5 Caenorhabditis elegans
B1JCW0 7.98e-59 195 36 4 330 3 moaA GTP 3',8-cyclase Pseudomonas putida (strain W619)
Q39055 8.87e-59 196 34 5 315 1 CNX2 GTP 3',8-cyclase, mitochondrial Arabidopsis thaliana
Q8IQF1 1.29e-58 201 36 8 313 2 Mocs1 Molybdenum cofactor biosynthesis protein 1 Drosophila melanogaster
Q9HXD6 1.51e-58 194 36 4 326 3 moaA1 GTP 3',8-cyclase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6U9U3 1.74e-58 194 34 5 333 3 moaA GTP 3',8-cyclase Sinorhizobium medicae (strain WSM419)
B1KU20 1.81e-58 194 32 5 325 3 moaA GTP 3',8-cyclase Clostridium botulinum (strain Loch Maree / Type A3)
C1FPG7 3.45e-58 193 32 5 325 3 moaA GTP 3',8-cyclase Clostridium botulinum (strain Kyoto / Type A2)
A5I365 3.45e-58 193 32 5 325 3 moaA GTP 3',8-cyclase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FUZ6 3.45e-58 193 32 5 325 3 moaA GTP 3',8-cyclase Clostridium botulinum (strain ATCC 19397 / Type A)
Q1I6J5 9.31e-58 192 35 4 329 3 moaA GTP 3',8-cyclase Pseudomonas entomophila (strain L48)
Q9ZIM6 1.53e-57 192 35 5 307 3 moaA GTP 3',8-cyclase Staphylococcus carnosus (strain TM300)
Q747W9 2.6e-57 191 37 4 308 3 moaA GTP 3',8-cyclase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q44118 3.1e-57 191 35 8 344 1 moaA GTP 3',8-cyclase Paenarthrobacter nicotinovorans
A5CYZ0 4.32e-57 190 35 3 313 3 moaA GTP 3',8-cyclase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q88WY1 7.52e-57 190 33 3 316 3 moaA GTP 3',8-cyclase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q3V7S1 7.77e-57 190 34 4 330 3 moaA GTP 3',8-cyclase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A7GEQ5 8.01e-57 189 32 4 324 3 moaA GTP 3',8-cyclase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C3KXJ8 1.08e-56 189 31 5 325 3 moaA GTP 3',8-cyclase Clostridium botulinum (strain 657 / Type Ba4)
Q0AVU6 1.25e-56 189 33 2 312 3 moaA GTP 3',8-cyclase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q97HL8 2e-56 188 32 5 304 3 moaA GTP 3',8-cyclase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q54NM6 2.67e-56 196 33 3 310 3 mocs1 Molybdenum cofactor biosynthesis protein 1 Dictyostelium discoideum
Q88E69 3.37e-56 188 35 4 330 3 moaA GTP 3',8-cyclase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B3QCQ7 3.79e-56 188 33 4 330 3 moaA GTP 3',8-cyclase Rhodopseudomonas palustris (strain TIE-1)
Q5HX04 3.86e-56 187 35 6 308 3 moaA GTP 3',8-cyclase Campylobacter jejuni (strain RM1221)
A1VXP5 3.9e-56 187 35 6 308 3 moaA GTP 3',8-cyclase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PIW6 3.9e-56 187 35 6 308 3 moaA GTP 3',8-cyclase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FJX0 3.9e-56 187 35 6 308 3 moaA GTP 3',8-cyclase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A5VQC9 5.28e-56 188 33 2 311 3 moaA GTP 3',8-cyclase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A5VZZ2 5.63e-56 187 35 4 330 3 moaA GTP 3',8-cyclase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q8G0X4 8.18e-56 187 33 2 311 3 moaA GTP 3',8-cyclase Brucella suis biovar 1 (strain 1330)
B0CLT0 8.18e-56 187 33 2 311 3 moaA GTP 3',8-cyclase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9MAX5 8.18e-56 187 33 2 311 3 moaA GTP 3',8-cyclase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B1IN35 9.13e-56 187 32 4 324 3 moaA GTP 3',8-cyclase Clostridium botulinum (strain Okra / Type B1)
Q2RGL2 9.25e-56 187 34 4 315 3 moaA GTP 3',8-cyclase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8YGY6 1.24e-55 187 33 2 311 3 moaA GTP 3',8-cyclase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RIT4 1.24e-55 187 33 2 311 3 moaA GTP 3',8-cyclase Brucella melitensis biotype 2 (strain ATCC 23457)
Q92PB4 2.04e-55 187 34 5 333 3 moaA GTP 3',8-cyclase Rhizobium meliloti (strain 1021)
A7H1N9 2.57e-55 186 35 6 308 3 moaA GTP 3',8-cyclase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
B5ZRM8 2.85e-55 186 34 4 329 3 moaA GTP 3',8-cyclase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A1B4A2 3.02e-55 186 36 3 308 3 moaA GTP 3',8-cyclase Paracoccus denitrificans (strain Pd 1222)
A8LIR8 3.91e-55 186 34 7 339 3 moaA GTP 3',8-cyclase Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
C0Z9B3 4.56e-55 185 36 9 331 3 moaA GTP 3',8-cyclase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q98MK6 6.23e-55 185 33 6 331 3 moaA GTP 3',8-cyclase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8CNE6 6.39e-55 185 34 6 312 3 moaA GTP 3',8-cyclase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HLY1 6.39e-55 185 34 6 312 3 moaA GTP 3',8-cyclase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4ZU05 6.82e-55 185 35 4 327 3 moaA GTP 3',8-cyclase Pseudomonas syringae pv. syringae (strain B728a)
Q48HV8 6.82e-55 185 35 4 327 3 moaA GTP 3',8-cyclase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q57DG3 8.42e-55 185 33 2 311 3 moaA GTP 3',8-cyclase Brucella abortus biovar 1 (strain 9-941)
Q2YNT7 8.42e-55 185 33 2 311 3 moaA GTP 3',8-cyclase Brucella abortus (strain 2308)
B2S5I1 8.42e-55 185 33 2 311 3 moaA GTP 3',8-cyclase Brucella abortus (strain S19)
Q65DY5 9.03e-55 185 35 7 340 3 moaA GTP 3',8-cyclase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q2K7L4 9.85e-55 185 34 4 329 3 moaA GTP 3',8-cyclase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B0KST1 1.1e-54 184 35 4 327 3 moaA GTP 3',8-cyclase Pseudomonas putida (strain GB-1)
A0RMJ2 1.18e-54 184 36 5 282 3 moaA GTP 3',8-cyclase Campylobacter fetus subsp. fetus (strain 82-40)
Q882V6 1.23e-54 184 35 4 327 3 moaA GTP 3',8-cyclase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q9WX96 1.67e-54 183 32 4 309 3 moaA GTP 3',8-cyclase Clostridium perfringens (strain 13 / Type A)
B8HWW4 1.69e-54 184 36 6 325 3 moaA GTP 3',8-cyclase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q0SS32 2.61e-54 183 32 4 309 3 moaA GTP 3',8-cyclase Clostridium perfringens (strain SM101 / Type A)
A0LVG0 3.39e-54 184 35 5 320 3 moaA GTP 3',8-cyclase Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q0TPG6 5.29e-54 182 32 4 309 3 moaA GTP 3',8-cyclase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8UER0 6.28e-54 183 33 4 330 3 moaA GTP 3',8-cyclase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8PNH1 6.58e-54 182 36 5 293 3 moaA GTP 3',8-cyclase Xanthomonas axonopodis pv. citri (strain 306)
Q7NCF5 8.3e-54 182 35 6 321 3 moaA GTP 3',8-cyclase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q8NR60 1.06e-53 183 35 9 338 3 moaA GTP 3',8-cyclase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
B3PQ08 2.73e-53 181 33 4 329 3 moaA GTP 3',8-cyclase Rhizobium etli (strain CIAT 652)
A6Q5D0 6.57e-53 179 35 4 282 3 moaA GTP 3',8-cyclase Nitratiruptor sp. (strain SB155-2)
B1XLR4 7.26e-53 179 36 7 327 3 moaA GTP 3',8-cyclase Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q931G4 8.25e-53 179 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A7X5J1 8.25e-53 179 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain Mu3 / ATCC 700698)
P59038 1.27e-52 179 32 5 325 3 moaA GTP 3',8-cyclase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P65389 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain MW2)
A8Z366 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G754 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain MSSA476)
P65388 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain N315)
A6QJA8 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain Newman)
Q5HDT9 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain COL)
A5IV50 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain JH9)
P69848 2.4e-52 178 33 7 322 1 moaA GTP 3',8-cyclase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEM4 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain USA300)
A6U3Z2 2.4e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain JH1)
Q6GEG6 2.78e-52 178 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain MRSA252)
B0CDZ6 2.91e-52 178 34 6 329 3 moaA GTP 3',8-cyclase Acaryochloris marina (strain MBIC 11017)
A7GU01 4.83e-52 177 33 7 320 3 moaA GTP 3',8-cyclase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2JI46 9.86e-52 176 34 3 300 3 moaA GTP 3',8-cyclase Synechococcus sp. (strain JA-2-3B'a(2-13))
C3LA56 1.08e-51 177 33 8 342 3 moaA GTP 3',8-cyclase Bacillus anthracis (strain CDC 684 / NRRL 3495)
Q4L8D2 1.27e-51 176 33 5 306 3 moaA GTP 3',8-cyclase Staphylococcus haemolyticus (strain JCSC1435)
Q2YYS8 1.29e-51 176 33 7 322 3 moaA GTP 3',8-cyclase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A7Z9P0 1.33e-51 176 34 7 338 3 moaA GTP 3',8-cyclase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A4QDF8 1.43e-51 177 34 9 338 3 moaA GTP 3',8-cyclase Corynebacterium glutamicum (strain R)
B2J1M7 1.58e-51 176 34 5 324 3 moaA GTP 3',8-cyclase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q3MC34 1.69e-51 176 34 5 324 3 moaA GTP 3',8-cyclase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B0JNC2 1.89e-51 176 35 7 328 3 moaA GTP 3',8-cyclase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q9K9W9 3.04e-51 176 35 9 324 3 moaA GTP 3',8-cyclase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q8YQG6 3.13e-51 175 34 5 324 3 moaA GTP 3',8-cyclase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
A8ERS0 1.08e-50 174 33 9 317 3 moaA GTP 3',8-cyclase Aliarcobacter butzleri (strain RM4018)
Q2NCE3 1.25e-50 174 33 5 330 3 moaA GTP 3',8-cyclase Erythrobacter litoralis (strain HTCC2594)
Q8Y0K4 1.32e-50 174 33 8 345 3 moaA GTP 3',8-cyclase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A6Q6R2 2.71e-50 172 34 4 282 3 moaA GTP 3',8-cyclase Sulfurovum sp. (strain NBC37-1)
O67929 6.25e-50 171 33 5 320 3 moaA GTP 3',8-cyclase Aquifex aeolicus (strain VF5)
Q9AC48 9.99e-50 172 33 7 334 3 moaA GTP 3',8-cyclase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B9L851 1.05e-49 171 34 4 284 3 moaA GTP 3',8-cyclase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q7UT69 1.41e-49 172 32 6 320 3 moaA GTP 3',8-cyclase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
B0RTE0 1.61e-49 171 35 5 290 3 moaA GTP 3',8-cyclase Xanthomonas campestris pv. campestris (strain B100)
Q8PBX1 2.3e-49 171 35 5 290 3 moaA GTP 3',8-cyclase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URN0 2.3e-49 171 35 5 290 3 moaA GTP 3',8-cyclase Xanthomonas campestris pv. campestris (strain 8004)
Q3KAS8 2.86e-49 170 32 5 332 3 moaA GTP 3',8-cyclase Pseudomonas fluorescens (strain Pf0-1)
Q119N9 3e-49 170 33 8 324 3 moaA GTP 3',8-cyclase Trichodesmium erythraeum (strain IMS101)
B1X0G3 3.08e-49 170 32 8 337 3 moaA GTP 3',8-cyclase Crocosphaera subtropica (strain ATCC 51142 / BH68)
A7GWA5 1.75e-48 168 34 4 283 3 moaA GTP 3',8-cyclase Campylobacter curvus (strain 525.92)
B9KDV3 4.62e-48 167 33 5 279 3 moaA GTP 3',8-cyclase Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
Q49ZI6 9.25e-48 166 32 7 322 3 moaA GTP 3',8-cyclase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q9RJ47 9.69e-48 166 33 8 334 3 moaA GTP 3',8-cyclase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B7JWW6 1.11e-47 166 32 5 325 3 moaA GTP 3',8-cyclase Rippkaea orientalis (strain PCC 8801 / RF-1)
B6JM01 1.69e-46 162 29 8 322 3 moaA GTP 3',8-cyclase Helicobacter pylori (strain P12)
A7ZB87 3.21e-46 162 33 4 283 3 moaA GTP 3',8-cyclase Campylobacter concisus (strain 13826)
Q30P92 5.93e-46 161 34 8 292 3 moaA GTP 3',8-cyclase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
P56414 8.32e-46 161 30 8 319 3 moaA GTP 3',8-cyclase Helicobacter pylori (strain ATCC 700392 / 26695)
Q55369 9.16e-46 161 31 4 314 3 moaA GTP 3',8-cyclase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9ZL75 1.25e-45 160 29 10 324 3 moaA GTP 3',8-cyclase Helicobacter pylori (strain J99 / ATCC 700824)
P39757 3.1e-45 160 32 6 338 3 moaA GTP 3',8-cyclase Bacillus subtilis (strain 168)
P9WJS3 5.9e-45 160 32 5 283 2 moaA1 GTP 3',8-cyclase 1 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJS2 5.9e-45 160 32 5 283 3 moaA1 GTP 3',8-cyclase 1 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q7TX84 6.03e-45 159 32 5 283 3 moaA1 GTP 3',8-cyclase 1 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1CTA2 6.66e-45 158 29 8 319 3 moaA GTP 3',8-cyclase Helicobacter pylori (strain HPAG1)
Q0W3L5 3.28e-43 154 31 10 312 3 moaA Probable GTP 3',8-cyclase Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
P62589 7.92e-43 154 30 6 311 3 moaA3 GTP 3',8-cyclase 3 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P62588 7.92e-43 154 30 6 311 3 moaA3 GTP 3',8-cyclase 3 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B2HFA4 8.96e-42 151 33 8 333 3 moaA GTP 3',8-cyclase Mycobacterium marinum (strain ATCC BAA-535 / M)
O28273 1.67e-41 149 32 8 312 3 moaA Probable GTP 3',8-cyclase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8PX29 2.61e-41 149 33 10 287 3 moaA Probable GTP 3',8-cyclase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A0PKZ7 4.11e-41 149 33 8 333 3 moaA GTP 3',8-cyclase Mycobacterium ulcerans (strain Agy99)
Q1B3F3 6.89e-41 149 34 5 331 3 moaA GTP 3',8-cyclase Mycobacterium sp. (strain MCS)
A1ULP7 6.89e-41 149 34 5 331 3 moaA GTP 3',8-cyclase Mycobacterium sp. (strain KMS)
A3Q648 6.89e-41 149 34 5 331 3 moaA GTP 3',8-cyclase Mycobacterium sp. (strain JLS)
A0R443 2.78e-40 147 37 12 339 3 moaA GTP 3',8-cyclase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
O27593 7.84e-40 145 33 6 288 3 moaA Probable GTP 3',8-cyclase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q8TUG2 9.36e-40 145 33 9 283 3 moaA Probable GTP 3',8-cyclase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q979T0 6.01e-39 143 30 4 273 3 moaA Probable GTP 3',8-cyclase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Q3AVP9 7.26e-39 143 31 10 322 3 moaA GTP 3',8-cyclase Synechococcus sp. (strain CC9902)
P9WJS1 1.89e-38 142 33 7 335 1 moaA2 GTP 3',8-cyclase 2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJS0 1.89e-38 142 33 7 335 3 moaA2 GTP 3',8-cyclase 2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P65385 1.89e-38 142 33 7 335 3 moaA2 GTP 3',8-cyclase 2 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q50746 8.99e-38 139 33 5 273 3 moaA Probable GTP 3',8-cyclase Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
C1B1N5 1.77e-37 140 32 6 331 3 moaA GTP 3',8-cyclase Rhodococcus opacus (strain B4)
Q0S2N2 2.05e-37 139 31 6 332 3 moaA GTP 3',8-cyclase Rhodococcus jostii (strain RHA1)
Q971H1 2.14e-37 139 32 8 287 3 moaA Probable GTP 3',8-cyclase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Q9X5W3 6.49e-37 137 32 6 331 3 moaA GTP 3',8-cyclase Rhodobacter capsulatus
Q9HKZ7 1.54e-36 137 32 7 295 3 moaA Probable GTP 3',8-cyclase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q4J8T0 7.49e-36 134 31 8 273 3 moaA Probable GTP 3',8-cyclase Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770)
Q3AGB7 1.19e-35 135 32 10 316 3 moaA GTP 3',8-cyclase Synechococcus sp. (strain CC9605)
A4YH62 1.41e-35 134 30 9 301 3 moaA Probable GTP 3',8-cyclase Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2)
Q9EYN8 1.82e-35 134 30 11 353 3 moaA GTP 3',8-cyclase Synechococcus sp. (strain WH7803)
Q7U3H2 5.59e-35 133 32 9 318 3 moaA GTP 3',8-cyclase Parasynechococcus marenigrum (strain WH8102)
A4FYQ8 3.25e-34 130 29 8 273 3 moaA Probable GTP 3',8-cyclase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A6VJM2 4.83e-34 129 29 7 272 3 moaA Probable GTP 3',8-cyclase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
C3MXF3 7.73e-34 129 31 8 281 3 moaA Probable GTP 3',8-cyclase Sulfolobus islandicus (strain M.14.25 / Kamchatka #1)
C4KIH7 7.73e-34 129 31 8 281 3 moaA Probable GTP 3',8-cyclase Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
C3MZ99 7.73e-34 129 31 8 281 3 moaA Probable GTP 3',8-cyclase Sulfolobus islandicus (strain M.16.27)
A6US67 1.1e-33 128 31 9 273 3 moaA Probable GTP 3',8-cyclase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q8TV60 1.24e-33 129 30 10 315 3 moaA Probable GTP 3',8-cyclase Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q6LZQ3 1.42e-33 128 30 8 283 3 moaA Probable GTP 3',8-cyclase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
Q9V2G2 1.5e-33 128 30 8 310 3 moaA Probable GTP 3',8-cyclase Pyrococcus abyssi (strain GE5 / Orsay)
A6UX30 1.68e-33 128 28 8 283 3 moaA Probable GTP 3',8-cyclase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q5JHN5 2.31e-33 128 32 7 274 3 moaA Probable GTP 3',8-cyclase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q8U4J5 4.1e-33 127 30 12 317 3 moaA Probable GTP 3',8-cyclase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A9A661 4.2e-33 127 29 7 272 3 moaA Probable GTP 3',8-cyclase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
C3N7B9 5.97e-33 127 30 7 277 3 moaA Probable GTP 3',8-cyclase Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1)
C3MR64 5.97e-33 127 30 7 277 3 moaA Probable GTP 3',8-cyclase Sulfolobus islandicus (strain L.S.2.15 / Lassen #1)
Q58234 8.19e-33 126 27 6 277 3 moaA Probable GTP 3',8-cyclase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O57854 2e-32 125 31 9 307 3 moaA Probable GTP 3',8-cyclase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
C3NGB5 2.46e-32 125 30 7 277 3 moaA Probable GTP 3',8-cyclase Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2)
Q980F0 2.7e-32 125 30 8 281 3 moaA Probable GTP 3',8-cyclase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q8ZYE5 2.2e-29 117 28 10 320 3 moaA Probable GTP 3',8-cyclase Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
Q18G49 3.26e-29 117 31 7 276 3 moaA Probable GTP 3',8-cyclase Haloquadratum walsbyi (strain DSM 16790 / HBSQ001)
Q9YEV3 2.98e-27 112 28 11 335 3 moaA Probable GTP 3',8-cyclase Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)
Q9HST4 6.53e-26 108 29 9 294 3 moaA Probable GTP 3',8-cyclase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R2L5 6.53e-26 108 29 9 294 3 moaA Probable GTP 3',8-cyclase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q46BK8 8e-10 63 29 10 195 1 ahbC Fe-coproporphyrin III synthase Methanosarcina barkeri (strain Fusaro / DSM 804)
A0QSB8 4.71e-09 60 25 5 195 1 mftC Mycofactocin maturase MftC Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
P9WJ79 1.08e-08 59 26 5 196 1 mftC Mycofactocin maturase MftC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJ78 1.08e-08 59 26 5 196 3 mftC Mycofactocin maturase MftC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0PM49 4.47e-08 57 25 4 191 1 mftC Mycofactocin maturase MftC Mycobacterium ulcerans (strain Agy99)
Q59026 7.85e-08 56 25 10 171 3 MJ1632 Putative glycyl-radical enzyme activating enzyme MJ1632 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
A0A1H0NKS3 1.1e-07 55 25 5 158 1 vip6 S-adenosylmethionine-dependent nucleotide dehydratase Selenomonas ruminantium
P0DW53 1.13e-07 56 27 7 181 1 vip60 S-adenosylmethionine-dependent nucleotide dehydratase Lacinutrix mariniflava (strain JCM 13824 / KCCM 42306 / AKS432)
Q608P0 1.75e-07 55 26 3 158 3 pqqE PqqA peptide cyclase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A4XTR4 7.03e-07 53 27 4 158 3 pqqE PqqA peptide cyclase Pseudomonas mendocina (strain ymp)
Q72DS4 1.38e-06 53 25 4 148 1 ahbD AdoMet-dependent heme synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A0A1I5E523 1.46e-06 53 25 11 222 1 nirJ Pre-heme d1 synthase Paracoccus pantotrophus
Q58036 1.86e-06 52 23 4 156 1 MJ0619 7,8-dihydro-6-hydroxymethylpterin dimethyltransferase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P0DW52 2.91e-06 51 26 5 206 1 vip21 S-adenosylmethionine-dependent nucleotide dehydratase Lewinella persica (strain ATCC 23167 / DSM 23188 / NBRC 102663 / NCIMB 1396 / T-3)
A5VXG4 3.61e-06 51 25 4 158 3 pqqE PqqA peptide cyclase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88QV8 4.56e-06 51 25 4 158 3 pqqE PqqA peptide cyclase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
C1DEW5 7e-06 50 26 3 157 3 pqqE PqqA peptide cyclase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4K4U8 9.61e-06 50 24 4 158 3 pqqE PqqA peptide cyclase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P07782 1.01e-05 50 26 6 183 3 pqqE PqqA peptide cyclase Acinetobacter calcoaceticus
Q9I2C0 1.02e-05 50 25 9 244 3 pqqE PqqA peptide cyclase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02LD6 1.02e-05 50 25 9 244 3 pqqE PqqA peptide cyclase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VAB6 1.02e-05 50 25 9 244 3 pqqE PqqA peptide cyclase Pseudomonas aeruginosa (strain LESB58)
Q6F9I9 1.58e-05 49 24 4 158 3 pqqE PqqA peptide cyclase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q30Y73 1.84e-05 49 24 6 164 1 ahbD AdoMet-dependent heme synthase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P24427 2.47e-05 49 21 15 355 3 nifB FeMo cofactor biosynthesis protein NifB Rhizobium leguminosarum bv. trifolii
Q5H234 0.00014 47 25 6 174 3 pqqE PqqA peptide cyclase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P4Y9 0.00014 47 25 6 174 3 pqqE PqqA peptide cyclase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q01060 0.000145 47 23 6 225 3 pqqE PqqA peptide cyclase Pseudescherichia vulneris
Q48CT3 0.000174 46 24 4 158 3 pqqE PqqA peptide cyclase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZMC1 0.000183 46 24 4 158 3 pqqE PqqA peptide cyclase Pseudomonas syringae pv. syringae (strain B728a)
Q88A84 0.000225 46 24 4 158 3 pqqE PqqA peptide cyclase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
P59748 0.000585 45 24 3 157 3 pqqE PqqA peptide cyclase Kluyvera intermedia
D5EID4 0.000897 44 21 7 187 1 vip15 S-adenosylmethionine-dependent nucleotide dehydratase Coraliomargarita akajimensis (strain DSM 45221 / IAM 15411 / JCM 23193 / KCTC 12865 / 04OKA010-24)
A0A110A2W7 0.001 43 23 9 184 1 vip50 S-adenosylmethionine-dependent nucleotide dehydratase Thermoplasmatales archaeon (strain ISO4-H5)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_04385
Feature type CDS
Gene moaA
Product GTP 3',8-cyclase MoaA
Location 206227 - 207210 (strand: -1)
Length 984 (nucleotides) / 327 (amino acids)

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1486
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04055 Radical SAM superfamily
PF06463 Molybdenum Cofactor Synthesis C
PF13353 4Fe-4S single cluster domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2896 Coenzyme transport and metabolism (H) H GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA)

Kegg Ortholog Annotation(s)

Protein Sequence

MTEQLTDPFARKFYYLRLSVTDVCNFRCNYCLPDGYKPNGHKSFLSLGEIRRVTRAFAQLGTEKIRLTGGEPTMRRDFTDIVAAIRENENIRTIAVTTNGYRMARDIRDWRAAGLNAVNVSVDSLDPRQFHAITGQDKFMQVMSGIDAAFDAGFEKVKVNVVLMKNVNDIHLPAFLNWIKDRPIQLRFIELMETGDGSDVFRRFHISGNVIRARLLQAGWQQVARARSDGPAQVFSHPDYQGEIGLIMPYEKDFCQSCNRLRVSAVGNLHLCLFGEQGITLRDLLAEDGHDAELKARLQRALQHKRETHFLHQGDSGITPNLSVIGG

Flanking regions ( +/- flanking 50bp)

CCAGGGTGCAGGATAGAAATGTCCGCATCTCCCGTATTTGGAAAGGTGTTATGACTGAACAACTGACAGATCCCTTTGCGCGCAAATTTTACTATCTGCGCCTCTCCGTGACAGATGTTTGCAATTTCCGTTGCAACTATTGTCTGCCTGATGGTTATAAACCAAACGGACACAAATCCTTTCTTTCTCTCGGCGAAATCCGCCGGGTGACCCGCGCGTTTGCTCAGCTGGGCACGGAAAAAATCCGTCTGACCGGCGGTGAGCCGACCATGCGCCGCGATTTTACCGATATCGTTGCCGCTATCCGCGAAAATGAGAATATCCGCACCATTGCCGTGACCACCAACGGTTACCGCATGGCACGGGATATCCGCGACTGGCGTGCCGCCGGGCTGAACGCCGTGAATGTCAGCGTTGACAGTCTCGACCCGCGCCAGTTTCACGCTATCACCGGGCAGGATAAATTCATGCAGGTGATGAGTGGTATCGATGCCGCGTTTGACGCCGGTTTTGAGAAGGTAAAAGTGAATGTGGTGCTGATGAAGAATGTTAATGACATCCATCTGCCTGCATTTCTGAACTGGATCAAAGACCGCCCGATTCAGCTGCGTTTTATCGAACTGATGGAAACCGGTGACGGCAGCGATGTGTTCCGCCGTTTCCATATCTCCGGCAATGTTATCCGTGCCCGTCTGTTACAGGCAGGCTGGCAGCAGGTGGCGCGTGCCCGCAGTGACGGCCCGGCACAGGTATTCAGTCATCCGGATTATCAGGGCGAAATCGGCCTGATCATGCCGTATGAAAAAGACTTCTGTCAGAGCTGTAACCGTCTGCGGGTGTCTGCGGTCGGTAATCTGCATCTGTGCCTGTTCGGCGAGCAGGGGATCACATTGCGTGACCTGCTGGCGGAAGACGGACACGATGCGGAGCTGAAAGCACGGCTTCAGCGCGCATTGCAGCACAAACGCGAAACCCATTTCCTCCATCAGGGGGACAGTGGTATTACCCCGAATTTATCCGTTATCGGCGGCTGATCCGCCGGTCATATCAGGAGTTTACATGTCTCAACTCACCCATATTAATG