Homologs in group_1248

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07265 FBDBKF_07265 100.0 Morganella morganii S1 pncB nicotinate phosphoribosyltransferase
NLDBIP_03705 NLDBIP_03705 100.0 Morganella morganii S4 pncB nicotinate phosphoribosyltransferase
LHKJJB_09535 LHKJJB_09535 100.0 Morganella morganii S3 pncB nicotinate phosphoribosyltransferase
HKOGLL_09440 HKOGLL_09440 100.0 Morganella morganii S5 pncB nicotinate phosphoribosyltransferase
F4V73_RS01450 F4V73_RS01450 90.8 Morganella psychrotolerans pncB nicotinate phosphoribosyltransferase
PMI_RS03775 PMI_RS03775 75.7 Proteus mirabilis HI4320 pncB nicotinate phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_1248

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1248

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EVC0 0.0 659 75 0 404 3 pncB Nicotinate phosphoribosyltransferase Proteus mirabilis (strain HI4320)
Q7N621 0.0 644 74 0 404 3 pncB Nicotinate phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GCJ6 0.0 599 71 2 403 3 pncB Nicotinate phosphoribosyltransferase Serratia proteamaculans (strain 568)
A1JMP2 0.0 591 70 2 403 3 pncB Nicotinate phosphoribosyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q6D454 0.0 590 69 2 403 3 pncB Nicotinate phosphoribosyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DFB8 0.0 589 70 2 403 3 pncB Nicotinate phosphoribosyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q66CG6 0.0 585 69 2 403 3 pncB Nicotinate phosphoribosyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZG93 0.0 585 69 2 403 1 pncB Nicotinate phosphoribosyltransferase Yersinia pestis
A7FJU4 0.0 585 69 2 403 3 pncB Nicotinate phosphoribosyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VC92 0.0 583 68 2 403 3 pncB Nicotinate phosphoribosyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B7N398 0.0 572 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B1LJT2 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7NM43 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
P18133 0.0 570 68 3 403 1 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain K12)
B1X8N5 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQ57 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7MS49 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O81 (strain ED1a)
B7MHP0 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3Z3I9 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Shigella sonnei (strain Ss046)
Q83LN3 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Shigella flexneri
Q31YR6 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Shigella boydii serotype 4 (strain Sb227)
B6I904 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain SE11)
A7ZYN4 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O9:H4 (strain HS)
B7M860 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O8 (strain IAI1)
B7LE31 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZK22 0.0 570 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8FJ98 0.0 569 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7UN17 0.0 569 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q2NU84 0.0 568 68 2 400 3 pncB Nicotinate phosphoribosyltransferase Sodalis glossinidius (strain morsitans)
B2TUE4 0.0 568 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
C5BD56 0.0 568 67 2 403 3 pncB Nicotinate phosphoribosyltransferase Edwardsiella ictaluri (strain 93-146)
Q32E52 0.0 568 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B5YT65 0.0 567 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDE8 0.0 567 68 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O157:H7
A4W8V0 0.0 563 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Enterobacter sp. (strain 638)
A9MHU8 0.0 558 67 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AIE5 0.0 558 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7LNU8 0.0 556 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A7MEW8 0.0 556 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
B5BBM4 0.0 553 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella paratyphi A (strain AKU_12601)
A9N6Y6 0.0 553 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGD8 0.0 553 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T172 0.0 553 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella newport (strain SL254)
B4TRW6 0.0 552 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella schwarzengrund (strain CVM19633)
C0PXX2 0.0 551 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella paratyphi C (strain RKS4594)
B5R8M1 0.0 551 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZD8 0.0 551 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FQ81 0.0 551 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella dublin (strain CT_02021853)
Q57QZ3 0.0 550 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella choleraesuis (strain SC-B67)
B5F1U0 0.0 550 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella agona (strain SL483)
P22253 0.0 550 66 3 403 1 pncB Nicotinate phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TDS5 0.0 550 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella heidelberg (strain SL476)
Q8Z7Y9 0.0 546 66 3 403 3 pncB Nicotinate phosphoribosyltransferase Salmonella typhi
Q8K9I6 4.61e-180 509 58 2 397 3 pncB Nicotinate phosphoribosyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
B8D7P8 1.4e-176 501 59 2 391 3 pncB Nicotinate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57442 1.4e-176 501 59 2 391 3 pncB Nicotinate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9E6 1.4e-176 501 59 2 391 3 pncB Nicotinate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q6LRA6 2e-154 444 52 3 399 3 pncB Nicotinate phosphoribosyltransferase Photobacterium profundum (strain SS9)
A4XS60 1.13e-144 419 53 3 394 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas mendocina (strain ymp)
Q9HUP4 2.38e-140 409 51 3 395 3 pncB1 Nicotinate phosphoribosyltransferase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HW26 6.89e-138 402 51 3 391 1 pncB2 Nicotinate phosphoribosyltransferase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3KIW4 7.03e-138 402 51 4 399 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q48NY1 5.61e-133 390 50 4 393 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZYV7 1.4e-132 389 50 4 393 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q87VL5 2.36e-130 384 50 3 392 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88DF7 8.28e-124 367 49 4 400 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W9Q6 4.88e-123 365 49 4 400 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KKX3 1.43e-122 363 49 4 400 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas putida (strain GB-1)
Q7NSK2 6.79e-112 336 46 7 400 3 pncB Nicotinate phosphoribosyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6F6W1 1.01e-110 333 44 3 397 1 pncB Nicotinate phosphoribosyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9JTM8 2.97e-110 332 44 5 398 3 pncB Nicotinate phosphoribosyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JYM9 3.09e-109 329 44 5 398 3 pncB Nicotinate phosphoribosyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0T9 5.04e-109 329 44 5 398 3 pncB Nicotinate phosphoribosyltransferase Neisseria meningitidis serogroup C (strain 053442)
A3MA25 5.36e-108 326 43 6 407 3 pncB Nicotinate phosphoribosyltransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B4RL23 8.28e-108 326 44 5 398 3 pncB Nicotinate phosphoribosyltransferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F836 8.28e-108 326 44 5 398 3 pncB Nicotinate phosphoribosyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B2I1P1 1.16e-107 325 43 6 407 3 pncB Nicotinate phosphoribosyltransferase Acinetobacter baumannii (strain ACICU)
Q87JE4 4.14e-104 317 41 7 415 3 pncB Nicotinate phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q128P8 8.09e-103 313 41 5 400 3 pncB Nicotinate phosphoribosyltransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q63S63 1.08e-102 313 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia pseudomallei (strain K96243)
Q62LW1 1.08e-102 313 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia mallei (strain ATCC 23344)
Q3BPD5 1.28e-102 312 43 7 395 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A4G168 1.42e-102 312 43 5 398 3 pncB Nicotinate phosphoribosyltransferase Herminiimonas arsenicoxydans
Q8PGU5 1.7e-102 312 43 7 395 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q8DA38 2.32e-102 313 42 8 405 3 pncB Nicotinate phosphoribosyltransferase Vibrio vulnificus (strain CMCP6)
A7N4I5 1.14e-101 311 40 6 409 3 pncB Nicotinate phosphoribosyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q1BXX4 1.86e-101 309 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia orbicola (strain AU 1054)
A0K5S6 1.86e-101 309 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia cenocepacia (strain HI2424)
Q0BH38 3.61e-101 308 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1JY80 4.44e-101 308 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia orbicola (strain MC0-3)
B1YVJ0 4.68e-101 308 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia ambifaria (strain MC40-6)
B0RVE9 4.79e-101 308 43 7 400 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q7MK41 1.09e-100 309 42 8 405 3 pncB Nicotinate phosphoribosyltransferase Vibrio vulnificus (strain YJ016)
A4JCM8 1.43e-100 307 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
C3LUC2 1.76e-100 308 42 7 404 3 pncB Nicotinate phosphoribosyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KN67 1.76e-100 308 42 7 404 1 pncB Nicotinate phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1F1 1.76e-100 308 42 7 404 3 pncB Nicotinate phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q8PCP3 2.07e-100 306 43 7 400 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQS8 2.07e-100 306 43 7 400 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain 8004)
A1SVJ9 1.36e-99 305 43 10 397 3 pncB Nicotinate phosphoribosyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1W8S8 1.32e-98 302 41 9 404 3 pncB Nicotinate phosphoribosyltransferase Acidovorax sp. (strain JS42)
B9MHC7 1.32e-98 302 41 9 404 3 pncB Nicotinate phosphoribosyltransferase Acidovorax ebreus (strain TPSY)
Q0K8J9 2.55e-98 301 40 5 394 3 pncB Nicotinate phosphoribosyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A9IIC5 3.04e-98 301 40 5 394 3 pncB Nicotinate phosphoribosyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1WJL0 1.4e-97 300 40 8 411 3 pncB Nicotinate phosphoribosyltransferase Verminephrobacter eiseniae (strain EF01-2)
Q8Y0L2 7.6e-97 297 40 6 394 3 pncB Nicotinate phosphoribosyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7VTF7 1.04e-95 295 40 5 397 3 pncB Nicotinate phosphoribosyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W5G3 1.08e-95 295 40 5 397 3 pncB Nicotinate phosphoribosyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WCZ8 1.26e-95 295 40 5 397 3 pncB Nicotinate phosphoribosyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B2U8V2 1.47e-95 294 39 6 394 3 pncB Nicotinate phosphoribosyltransferase Ralstonia pickettii (strain 12J)
Q87EC4 1.07e-94 292 41 7 394 3 pncB Nicotinate phosphoribosyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q9PED1 2.14e-94 291 40 6 394 3 pncB Nicotinate phosphoribosyltransferase Xylella fastidiosa (strain 9a5c)
C0QFM5 2.82e-79 252 38 9 390 3 pncB Nicotinate phosphoribosyltransferase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q8PSJ3 4.35e-78 249 37 9 394 3 pncB Nicotinate phosphoribosyltransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q1QZ10 1.49e-77 248 39 12 389 3 pncB Nicotinate phosphoribosyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q8TMW6 1.63e-77 248 36 8 395 3 pncB Nicotinate phosphoribosyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q12Z05 8.33e-76 244 37 10 391 3 pncB Nicotinate phosphoribosyltransferase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
B9JYR4 3.61e-64 214 37 11 408 3 pncB Nicotinate phosphoribosyltransferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A6U5X9 6.9e-61 206 35 9 407 3 pncB Nicotinate phosphoribosyltransferase Sinorhizobium medicae (strain WSM419)
B9J6S5 7.32e-60 203 34 9 401 3 pncB Nicotinate phosphoribosyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q92S49 2.66e-59 202 35 9 401 3 pncB Nicotinate phosphoribosyltransferase Rhizobium meliloti (strain 1021)
Q2KDT0 3.15e-59 201 34 9 401 3 pncB Nicotinate phosphoribosyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P39683 3.76e-59 201 32 14 415 1 NPT1 Nicotinate phosphoribosyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B3PXL5 7.27e-59 201 34 9 401 3 pncB Nicotinate phosphoribosyltransferase Rhizobium etli (strain CIAT 652)
C3MFW1 2.73e-58 199 35 9 401 3 pncB Nicotinate phosphoribosyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B5ZWU4 4.2e-58 199 34 9 401 3 pncB Nicotinate phosphoribosyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q98D24 2.14e-57 197 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8UIS9 1.76e-56 194 33 9 401 1 pncB Nicotinate phosphoribosyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9UTK3 4.33e-56 192 32 14 412 3 SPAC1486.06 Probable nicotinate phosphoribosyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q89SS3 1.44e-54 189 34 10 417 3 pncB Nicotinate phosphoribosyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8G340 1.94e-54 189 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Brucella suis biovar 1 (strain 1330)
B0CIM5 1.94e-54 189 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RGH3 1.94e-54 189 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
Q57FQ9 1.94e-54 189 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YNV6 1.94e-54 189 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Brucella abortus (strain 2308)
B2S8A9 1.94e-54 189 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Brucella abortus (strain S19)
A9M757 2.71e-54 189 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q6G0X7 3.64e-54 188 34 9 401 3 pncB Nicotinate phosphoribosyltransferase Bartonella quintana (strain Toulouse)
Q6G5H6 1.23e-53 187 33 9 401 3 pncB Nicotinate phosphoribosyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q1QI14 1.26e-53 187 35 11 411 3 pncB Nicotinate phosphoribosyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q8YEP2 2.92e-53 186 34 9 407 3 pncB Nicotinate phosphoribosyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A6WV52 5.2e-53 185 34 10 407 3 pncB Nicotinate phosphoribosyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A5E8V7 7.2e-53 185 34 10 410 3 pncB Nicotinate phosphoribosyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A4YK54 1.24e-52 184 34 12 420 3 pncB Nicotinate phosphoribosyltransferase Bradyrhizobium sp. (strain ORS 278)
A9ILN1 6.87e-52 182 34 10 402 3 pncB Nicotinate phosphoribosyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q11HJ2 6.75e-51 179 33 10 410 3 pncB Nicotinate phosphoribosyltransferase Chelativorans sp. (strain BNC1)
A1UUA2 2.03e-49 175 32 9 403 3 pncB Nicotinate phosphoribosyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
P9WJI7 6.98e-07 54 26 14 379 1 pncB2 Nicotinate phosphoribosyltransferase pncB2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WJI6 6.98e-07 54 26 14 379 2 pncB2 Nicotinate phosphoribosyltransferase pncB2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03705
Feature type CDS
Gene pncB
Product nicotinate phosphoribosyltransferase
Location 53091 - 54305 (strand: 1)
Length 1215 (nucleotides) / 404 (amino acids)

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1248
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04095 Nicotinate phosphoribosyltransferase (NAPRTase) family
PF17767 Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1488 Coenzyme transport and metabolism (H) H Nicotinic acid phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00763 nicotinate phosphoribosyltransferase [EC:6.3.4.21] Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of cofactors
-

Protein Sequence

MNSEATPIITSLLDTDAYKLHMQQAVFHHYRSIPVVAEFRCRSSKRLGQYADELRRRVAMMAELSVSDDEYNYLARLPFFSADYLAWFRQFRFDPSQVNIHCDSNGQLAVRISGPWVEVILWEVPLLALISELVHHHESPQVTPEDAVIRLRELVARFYQDAEQAGLDLSRFKLMDFGTRRRFSFDVQKAIVTELKQHFPYLVGTSNYLLAEKLDLEPVGTQAHEWFQAHQQISAELANSQRAALQTWLDEYPDQLGVALTDCITMDAFLRDFDTPFARAYQGLRHDSGDPVEWGEKAIAHYEKLGIDPMSKTLVFSDNLDFRKALALYAHFCDRINLVFGIGTRLTCNIPDVEPLNIVIKLVECNGKPVAKLSDSPGKTICEDDEFVDKLRRAFDIPHVQRAC

Flanking regions ( +/- flanking 50bp)

AAGCTATAACCTGTTTAGGTTGATTGCTCCGTGAGGATGCTGAAAGCGCCATGAATTCAGAAGCAACCCCGATTATCACATCACTGCTGGATACCGATGCGTATAAGCTGCATATGCAGCAGGCAGTGTTCCATCATTACCGCTCAATTCCTGTGGTCGCGGAATTCCGCTGCCGGAGCAGCAAACGGCTGGGGCAGTACGCAGATGAACTGCGCCGCCGGGTGGCAATGATGGCAGAGCTGTCAGTCAGTGATGACGAGTACAACTACCTGGCCCGCCTGCCGTTCTTTTCGGCAGACTACCTCGCCTGGTTCCGTCAGTTCCGTTTTGATCCGTCACAGGTAAATATCCACTGTGACAGCAACGGCCAGCTGGCTGTCCGTATCAGCGGCCCCTGGGTGGAGGTTATCCTATGGGAAGTGCCGCTGCTGGCGCTGATCAGTGAACTCGTCCACCACCATGAATCACCGCAGGTCACGCCGGAAGATGCCGTTATCCGTCTGCGTGAGCTGGTGGCGCGTTTTTATCAGGATGCAGAGCAGGCCGGGCTGGATCTCAGCCGCTTTAAACTGATGGATTTCGGTACCCGCCGCCGTTTCTCTTTTGATGTTCAGAAAGCCATTGTCACTGAACTGAAACAGCATTTCCCGTATCTGGTCGGCACCAGCAATTACCTGCTGGCGGAAAAACTCGATCTGGAACCGGTCGGTACCCAGGCGCATGAATGGTTCCAGGCACATCAGCAGATCAGTGCGGAACTGGCCAACAGCCAGCGCGCCGCTCTCCAGACCTGGCTTGATGAATATCCGGATCAGCTCGGTGTCGCACTGACAGACTGCATCACAATGGATGCTTTCCTGCGCGATTTCGATACCCCGTTTGCCCGCGCCTATCAGGGTCTGCGCCACGATTCCGGGGATCCGGTGGAATGGGGTGAAAAAGCCATTGCTCACTATGAAAAGCTGGGTATCGACCCGATGAGCAAAACGCTGGTCTTTTCAGATAACCTGGATTTCCGCAAAGCCCTCGCGCTTTATGCCCATTTCTGTGACCGGATAAATCTGGTATTCGGTATCGGCACCCGCCTGACCTGCAATATCCCGGATGTCGAGCCGCTCAATATTGTTATCAAGCTGGTGGAATGCAACGGTAAACCGGTTGCCAAACTCTCTGACAGCCCCGGCAAAACCATCTGTGAAGATGATGAATTTGTCGATAAACTGCGCCGCGCATTTGATATTCCCCACGTTCAGCGCGCCTGCTGATCCCTCCTTTTATATACCTGCTCCCGGAGAACAGAAAAAGACGGTTATTT