Homologs in group_1306

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07265 FBDBKF_07265 75.7 Morganella morganii S1 pncB nicotinate phosphoribosyltransferase
EHELCC_03705 EHELCC_03705 75.7 Morganella morganii S2 pncB nicotinate phosphoribosyltransferase
NLDBIP_03705 NLDBIP_03705 75.7 Morganella morganii S4 pncB nicotinate phosphoribosyltransferase
LHKJJB_09535 LHKJJB_09535 75.7 Morganella morganii S3 pncB nicotinate phosphoribosyltransferase
HKOGLL_09440 HKOGLL_09440 75.7 Morganella morganii S5 pncB nicotinate phosphoribosyltransferase
F4V73_RS01450 F4V73_RS01450 75.7 Morganella psychrotolerans pncB nicotinate phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_1306

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1306

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EVC0 0.0 841 100 0 404 3 pncB Nicotinate phosphoribosyltransferase Proteus mirabilis (strain HI4320)
Q7N621 0.0 660 76 0 404 3 pncB Nicotinate phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q66CG6 0.0 612 72 2 403 3 pncB Nicotinate phosphoribosyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZG93 0.0 612 72 2 403 1 pncB Nicotinate phosphoribosyltransferase Yersinia pestis
A7FJU4 0.0 612 72 2 403 3 pncB Nicotinate phosphoribosyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JMP2 0.0 603 70 2 403 3 pncB Nicotinate phosphoribosyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C6DFB8 0.0 599 70 2 403 3 pncB Nicotinate phosphoribosyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D454 0.0 596 69 2 403 3 pncB Nicotinate phosphoribosyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GCJ6 0.0 591 70 2 399 3 pncB Nicotinate phosphoribosyltransferase Serratia proteamaculans (strain 568)
C5BD56 0.0 575 68 2 403 3 pncB Nicotinate phosphoribosyltransferase Edwardsiella ictaluri (strain 93-146)
B2VC92 0.0 572 67 2 403 3 pncB Nicotinate phosphoribosyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MEW8 0.0 562 66 3 399 3 pncB Nicotinate phosphoribosyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
A4W8V0 0.0 560 66 3 399 3 pncB Nicotinate phosphoribosyltransferase Enterobacter sp. (strain 638)
Q2NU84 0.0 559 67 2 400 3 pncB Nicotinate phosphoribosyltransferase Sodalis glossinidius (strain morsitans)
A9MHU8 0.0 558 67 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5BBM4 0.0 557 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella paratyphi A (strain AKU_12601)
A9N6Y6 0.0 557 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PGD8 0.0 557 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T172 0.0 557 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella newport (strain SL254)
B4TRW6 0.0 556 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella schwarzengrund (strain CVM19633)
P18133 0.0 556 66 4 400 1 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain K12)
B1X8N5 0.0 556 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQ57 0.0 556 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7MS49 0.0 556 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O81 (strain ED1a)
B7MHP0 0.0 556 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3Z3I9 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Shigella sonnei (strain Ss046)
Q83LN3 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Shigella flexneri
Q31YR6 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Shigella boydii serotype 4 (strain Sb227)
B4TDS5 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella heidelberg (strain SL476)
B6I904 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain SE11)
A7ZYN4 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O9:H4 (strain HS)
B7M860 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O8 (strain IAI1)
B7LE31 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain 55989 / EAEC)
A7ZK22 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LJT2 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
Q8FJ98 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7NM43 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7UN17 0.0 555 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A8AIE5 0.0 555 65 4 400 3 pncB Nicotinate phosphoribosyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7N398 0.0 555 66 3 399 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
B2TUE4 0.0 554 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P22253 0.0 553 66 4 400 1 pncB Nicotinate phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C0PXX2 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella paratyphi C (strain RKS4594)
B5R8M1 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZD8 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FQ81 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella dublin (strain CT_02021853)
B5F1U0 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella agona (strain SL483)
Q32E52 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
Q57QZ3 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella choleraesuis (strain SC-B67)
B5YT65 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XDE8 0.0 553 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia coli O157:H7
B7LNU8 0.0 550 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q8Z7Y9 0.0 550 66 4 400 3 pncB Nicotinate phosphoribosyltransferase Salmonella typhi
B8D7P8 2.74e-179 507 60 3 397 3 pncB Nicotinate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57442 2.74e-179 507 60 3 397 3 pncB Nicotinate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9E6 2.74e-179 507 60 3 397 3 pncB Nicotinate phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q8K9I6 5.63e-179 506 59 2 394 3 pncB Nicotinate phosphoribosyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q6LRA6 4.56e-160 459 55 2 396 3 pncB Nicotinate phosphoribosyltransferase Photobacterium profundum (strain SS9)
A4XS60 3.73e-149 431 53 3 394 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas mendocina (strain ymp)
Q9HUP4 2.99e-145 421 51 3 395 3 pncB1 Nicotinate phosphoribosyltransferase 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HW26 9.44e-142 412 50 3 391 1 pncB2 Nicotinate phosphoribosyltransferase 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q3KIW4 1.21e-139 407 50 3 397 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q48NY1 1.57e-136 399 52 5 394 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZYV7 1.66e-136 399 51 5 394 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q87VL5 2.49e-134 394 50 3 392 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q88DF7 5.53e-129 380 49 3 395 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W9Q6 2.46e-128 378 48 3 395 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KKX3 9.42e-127 374 48 3 395 3 pncB Nicotinate phosphoribosyltransferase Pseudomonas putida (strain GB-1)
Q7NSK2 8.7e-111 333 45 8 401 3 pncB Nicotinate phosphoribosyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q87JE4 3.83e-109 330 42 8 419 3 pncB Nicotinate phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9JYM9 7.95e-109 328 43 3 397 3 pncB Nicotinate phosphoribosyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M0T9 1.14e-108 328 43 3 397 3 pncB Nicotinate phosphoribosyltransferase Neisseria meningitidis serogroup C (strain 053442)
Q6F6W1 3.32e-108 327 42 4 401 1 pncB Nicotinate phosphoribosyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C3LUC2 7.81e-108 327 43 7 406 3 pncB Nicotinate phosphoribosyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KN67 7.81e-108 327 43 7 406 1 pncB Nicotinate phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1F1 7.81e-108 327 43 7 406 3 pncB Nicotinate phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B4RL23 1.11e-107 325 43 3 397 3 pncB Nicotinate phosphoribosyltransferase Neisseria gonorrhoeae (strain NCCP11945)
Q5F836 1.11e-107 325 43 3 397 3 pncB Nicotinate phosphoribosyltransferase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JTM8 4.35e-107 324 43 3 397 3 pncB Nicotinate phosphoribosyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
B2I1P1 2.41e-106 322 42 5 404 3 pncB Nicotinate phosphoribosyltransferase Acinetobacter baumannii (strain ACICU)
A3MA25 3.3e-106 322 42 5 404 3 pncB Nicotinate phosphoribosyltransferase Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q3BPD5 1.01e-105 320 43 6 395 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PGU5 1.15e-105 320 43 6 395 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas axonopodis pv. citri (strain 306)
A7N4I5 1.7e-105 321 40 8 419 3 pncB Nicotinate phosphoribosyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q0K8J9 4.55e-105 318 42 6 394 3 pncB Nicotinate phosphoribosyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8DA38 7.23e-105 319 41 8 409 3 pncB Nicotinate phosphoribosyltransferase Vibrio vulnificus (strain CMCP6)
Q63S63 8.22e-105 318 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia pseudomallei (strain K96243)
Q62LW1 8.22e-105 318 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia mallei (strain ATCC 23344)
Q9PED1 1.42e-104 317 42 6 394 3 pncB Nicotinate phosphoribosyltransferase Xylella fastidiosa (strain 9a5c)
Q8Y0L2 6.51e-104 315 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7MK41 1.82e-103 316 41 8 409 3 pncB Nicotinate phosphoribosyltransferase Vibrio vulnificus (strain YJ016)
Q87EC4 3.09e-103 314 42 6 394 3 pncB Nicotinate phosphoribosyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q128P8 3.83e-103 313 40 8 403 3 pncB Nicotinate phosphoribosyltransferase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q0BH38 4.63e-103 313 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A4G168 4.69e-103 313 43 5 398 3 pncB Nicotinate phosphoribosyltransferase Herminiimonas arsenicoxydans
B0RVE9 5.46e-103 313 43 6 400 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain B100)
B1YVJ0 6.48e-103 313 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia ambifaria (strain MC40-6)
Q8PCP3 1.8e-102 312 43 6 400 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UQS8 1.8e-102 312 43 6 400 3 pncB Nicotinate phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain 8004)
A4JCM8 1.3e-101 310 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1JY80 3.1e-101 309 41 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia orbicola (strain MC0-3)
Q1BXX4 3.35e-101 309 41 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia orbicola (strain AU 1054)
A0K5S6 3.35e-101 309 41 5 394 3 pncB Nicotinate phosphoribosyltransferase Burkholderia cenocepacia (strain HI2424)
B2U8V2 5.76e-101 308 41 6 394 3 pncB Nicotinate phosphoribosyltransferase Ralstonia pickettii (strain 12J)
A9IIC5 2.51e-100 306 42 5 394 3 pncB Nicotinate phosphoribosyltransferase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1WJL0 8.09e-100 305 40 8 408 3 pncB Nicotinate phosphoribosyltransferase Verminephrobacter eiseniae (strain EF01-2)
A1W8S8 2.78e-99 304 39 5 401 3 pncB Nicotinate phosphoribosyltransferase Acidovorax sp. (strain JS42)
B9MHC7 2.78e-99 304 39 5 401 3 pncB Nicotinate phosphoribosyltransferase Acidovorax ebreus (strain TPSY)
Q7VTF7 3.53e-99 304 41 5 397 3 pncB Nicotinate phosphoribosyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WCZ8 3.81e-99 304 41 5 397 3 pncB Nicotinate phosphoribosyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W5G3 4.25e-99 303 41 5 397 3 pncB Nicotinate phosphoribosyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A1SVJ9 3.87e-96 296 41 9 396 3 pncB Nicotinate phosphoribosyltransferase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q8PSJ3 5.37e-82 259 38 9 398 3 pncB Nicotinate phosphoribosyltransferase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Q1QZ10 4.37e-81 257 40 10 387 3 pncB Nicotinate phosphoribosyltransferase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
C0QFM5 5.21e-79 251 39 10 392 3 pncB Nicotinate phosphoribosyltransferase Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q8TMW6 5.62e-78 249 37 7 390 3 pncB Nicotinate phosphoribosyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q12Z05 1.9e-77 248 36 9 390 3 pncB Nicotinate phosphoribosyltransferase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
B9JYR4 5.89e-64 214 36 13 413 3 pncB Nicotinate phosphoribosyltransferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
P39683 3.52e-62 209 32 13 411 1 NPT1 Nicotinate phosphoribosyltransferase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B9J6S5 1.94e-61 207 34 12 417 3 pncB Nicotinate phosphoribosyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A6U5X9 2.19e-60 204 35 11 410 3 pncB Nicotinate phosphoribosyltransferase Sinorhizobium medicae (strain WSM419)
Q2KDT0 3.96e-60 204 35 14 420 3 pncB Nicotinate phosphoribosyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6G0X7 4.31e-60 204 36 12 408 3 pncB Nicotinate phosphoribosyltransferase Bartonella quintana (strain Toulouse)
Q9UTK3 5.76e-60 202 33 11 413 3 SPAC1486.06 Probable nicotinate phosphoribosyltransferase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B3PXL5 7.17e-60 203 35 14 420 3 pncB Nicotinate phosphoribosyltransferase Rhizobium etli (strain CIAT 652)
B5ZWU4 4.29e-59 201 34 14 421 3 pncB Nicotinate phosphoribosyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q92S49 8.26e-59 200 35 13 413 3 pncB Nicotinate phosphoribosyltransferase Rhizobium meliloti (strain 1021)
Q6G5H6 2.28e-58 199 35 11 408 3 pncB Nicotinate phosphoribosyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
C3MFW1 5.19e-57 196 34 13 413 3 pncB Nicotinate phosphoribosyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A9ILN1 7.05e-57 195 35 12 409 3 pncB Nicotinate phosphoribosyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q8UIS9 7.35e-57 195 33 13 421 1 pncB Nicotinate phosphoribosyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
A1UUA2 1.76e-56 194 34 11 412 3 pncB Nicotinate phosphoribosyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q89SS3 4.66e-56 193 34 10 424 3 pncB Nicotinate phosphoribosyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q98D24 1.58e-55 192 33 11 409 3 pncB Nicotinate phosphoribosyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A5E8V7 1.78e-54 189 34 11 423 3 pncB Nicotinate phosphoribosyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8G340 2.08e-53 186 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Brucella suis biovar 1 (strain 1330)
B0CIM5 2.08e-53 186 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
C0RGH3 2.08e-53 186 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
Q57FQ9 2.08e-53 186 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YNV6 2.08e-53 186 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Brucella abortus (strain 2308)
B2S8A9 2.08e-53 186 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Brucella abortus (strain S19)
A9M757 3.42e-53 186 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A4YK54 1.76e-52 184 32 11 423 3 pncB Nicotinate phosphoribosyltransferase Bradyrhizobium sp. (strain ORS 278)
Q1QI14 2.76e-52 183 34 12 414 3 pncB Nicotinate phosphoribosyltransferase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q8YEP2 2.82e-52 183 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q11HJ2 4.2e-52 183 32 10 414 3 pncB Nicotinate phosphoribosyltransferase Chelativorans sp. (strain BNC1)
A6WV52 1.26e-51 181 32 11 414 3 pncB Nicotinate phosphoribosyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03775
Feature type CDS
Gene pncB
Product nicotinate phosphoribosyltransferase
Location 851862 - 853076 (strand: -1)
Length 1215 (nucleotides) / 404 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1306
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04095 Nicotinate phosphoribosyltransferase (NAPRTase) family
PF17767 Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1488 Coenzyme transport and metabolism (H) H Nicotinic acid phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00763 nicotinate phosphoribosyltransferase [EC:6.3.4.21] Nicotinate and nicotinamide metabolism
Metabolic pathways
Biosynthesis of cofactors
-

Protein Sequence

MILDATPIITSLLDTDAYKLHMQQAVYHHYSDIPVVAEFRCRSDERLGEYATTLRHQVDMMADLSLTNEEFGYLQSLPFFKNDYLQWFKHFRFKPEQVHIATTADNQLTIKITGPWREVILWEVPLLALVSEIVHRARSPQITADDAVIQLRKLIDIFYRDAAEQQIDLADFKLMDFGTRRRFSYDVQRAIVDELKNHFPYLIGTSNYHFAERMQLAPVGTQAHEWFQAHQQISPELANSQRAALQSWLDEYPDQLGIALTDCITMDAFLRDFDMPFASRYQGLRHDSGDPIEWGEKAIAHYEKLGIDPMSKVLVFSDSLDFQKALVLYKHFHKRIRLIFGIGTRLTCNIPNITPLNIVIKLVECNGKPVAKLSDSPGKTICEDDEFVDKLRKAFDVPLVRQAC

Flanking regions ( +/- flanking 50bp)

TTAACGATTTAGCTGACATAAAAACGCTCCGTGAGGATGCTTGACGCGCTATGATTTTAGACGCTACACCGATTATTACATCACTGTTGGATACCGATGCATACAAGCTCCACATGCAACAGGCGGTTTACCATCATTATAGTGATATTCCTGTCGTTGCTGAATTCCGCTGCCGGAGTGATGAACGTCTAGGTGAATATGCAACAACCTTACGCCATCAAGTGGATATGATGGCAGACTTGTCATTAACTAATGAAGAGTTTGGCTATCTTCAAAGCCTGCCTTTCTTTAAAAATGACTATCTGCAATGGTTTAAACATTTTCGCTTTAAACCCGAGCAAGTGCATATCGCGACCACTGCTGACAATCAATTGACGATTAAGATAACTGGCCCTTGGCGTGAAGTTATTTTATGGGAAGTTCCTTTGTTAGCATTGGTGAGTGAAATTGTCCACCGTGCTCGTTCGCCACAAATCACCGCTGATGACGCCGTTATTCAATTACGCAAACTTATCGATATTTTCTATCGTGATGCGGCTGAACAACAGATTGATTTAGCGGATTTCAAATTGATGGATTTTGGTACTCGTCGTCGCTTTTCTTATGATGTGCAACGTGCCATTGTCGATGAATTAAAAAATCATTTCCCTTATCTTATCGGCACTAGTAACTATCATTTTGCTGAACGTATGCAACTGGCCCCCGTAGGCACACAAGCCCATGAATGGTTCCAAGCACATCAGCAAATTAGTCCTGAGCTTGCCAATAGTCAACGGGCTGCATTGCAATCATGGCTAGATGAATACCCAGATCAACTCGGTATTGCACTCACTGATTGTATCACTATGGATGCATTCCTGCGTGACTTTGATATGCCATTCGCCAGCCGTTATCAAGGGTTACGTCATGACTCAGGTGATCCGATTGAATGGGGTGAAAAAGCCATTGCTCATTATGAAAAGCTCGGTATCGATCCGATGAGTAAAGTATTGGTATTCTCTGATAGCCTCGACTTTCAGAAAGCCTTAGTACTTTATAAGCATTTCCATAAGCGTATCCGCTTAATTTTTGGTATCGGCACCAGATTGACTTGTAATATCCCGAATATTACACCTCTTAATATTGTGATTAAGCTGGTGGAGTGTAATGGTAAACCTGTTGCTAAATTATCAGATAGTCCAGGTAAAACCATTTGTGAAGATGATGAGTTTGTCGACAAGCTACGTAAAGCCTTTGATGTTCCTCTTGTTAGGCAAGCTTGTTAATAAAGATTAAATCGCTATTTATTCACTCTATCTATTCTATCTATAAAGAA