Homologs in group_185

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07340 FBDBKF_07340 100.0 Morganella morganii S1 ompA porin OmpA
FBDBKF_20375 FBDBKF_20375 38.2 Morganella morganii S1 ompA OmpA family protein
NLDBIP_03630 NLDBIP_03630 100.0 Morganella morganii S4 ompA porin OmpA
LHKJJB_09460 LHKJJB_09460 100.0 Morganella morganii S3 ompA porin OmpA
HKOGLL_09515 HKOGLL_09515 100.0 Morganella morganii S5 ompA porin OmpA
F4V73_RS01525 F4V73_RS01525 89.8 Morganella psychrotolerans ompA porin OmpA
F4V73_RS19125 F4V73_RS19125 36.4 Morganella psychrotolerans - OmpA family protein
PMI_RS03855 PMI_RS03855 81.1 Proteus mirabilis HI4320 ompA porin OmpA

Distribution of the homologs in the orthogroup group_185

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_185

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P38399 0.0 509 68 2 358 1 ompA Outer membrane protein A Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZG77 0.0 509 68 2 358 1 ompA Outer membrane protein A Yersinia pestis
I2BAK7 2.7e-169 478 67 3 357 3 ompA Outer membrane protein A Shimwellia blattae (strain ATCC 29907 / DSM 4481 / JCM 1650 / NBRC 105725 / CDC 9005-74)
Q8Z7S0 8.87e-169 477 65 3 357 3 ompA Outer membrane protein A Salmonella typhi
P02936 2.71e-168 476 65 3 357 3 ompA Outer membrane protein A Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B7LNW7 4.11e-168 475 65 3 358 3 ompA Outer membrane protein A Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P0A910 8.35e-168 474 65 3 356 1 ompA Outer membrane protein A Escherichia coli (strain K12)
P0A911 8.35e-168 474 65 3 356 3 ompA Outer membrane protein A Escherichia coli O157:H7
P02935 8.75e-168 474 65 3 358 3 ompA Outer membrane protein A Shigella dysenteriae
A0A2S4N3N0 1.42e-167 474 66 3 357 1 ompA Outer membrane protein A Shigella flexneri
P09146 7.7e-167 472 65 3 356 3 ompA Outer membrane protein A Klebsiella aerogenes
P04845 2.9e-164 466 66 5 359 3 ompA Outer membrane protein A Serratia marcescens
P24017 2.58e-156 445 64 4 342 1 ompA Outer membrane protein A Klebsiella pneumoniae
P0DJO6 2.44e-111 327 67 1 242 3 ompA Outer membrane protein A (Fragment) Shimwellia blattae
P24754 3.29e-108 319 65 2 245 3 ompA Outer membrane protein A (Fragment) Atlantibacter hermannii
P0C8Z2 7.71e-108 318 64 2 244 3 ompA Outer membrane protein A (Fragment) Escherichia fergusonii
P24016 8.52e-107 315 64 2 242 3 ompA Outer membrane protein A (Fragment) Citrobacter freundii
P24755 5.78e-89 270 58 4 246 3 ompA Outer membrane protein A (Fragment) Serratia odorifera
P38368 7.6e-74 235 43 10 363 1 ompA Outer membrane protein P5 Haemophilus influenzae
P45996 3.58e-70 226 42 10 368 1 ompA Outer membrane protein P5 Haemophilus influenzae
P43840 3.73e-70 226 41 10 366 3 ompA Outer membrane protein P5 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57414 6.29e-58 194 30 6 351 3 ompA Outer membrane protein A Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K9L4 4.37e-55 187 30 4 348 3 ompA Outer membrane protein A Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q05146 4.37e-23 98 42 3 139 3 ompA Outer membrane protein A Bordetella avium
P07050 6.22e-23 99 39 4 165 3 None Outer membrane protein P.III Neisseria gonorrhoeae
P0A0V3 4.27e-18 85 37 3 147 1 rmpM Outer membrane protein class 4 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0V2 6.29e-18 85 37 3 147 3 rmpM Outer membrane protein class 4 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A0A160PB22 6.89e-12 68 36 3 115 1 tpgA Trimeric autotransporter adhesin- and peptidoglycan-associated protein A Acinetobacter sp. (strain Tol 5)
P37665 1.08e-10 64 33 2 125 1 yiaD Probable lipoprotein YiaD Escherichia coli (strain K12)
P13794 1.43e-09 62 27 8 226 1 oprF Outer membrane porin F Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P9WIU5 5.03e-09 60 33 2 115 1 arfA Peptidoglycan-binding protein ArfA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIU4 5.03e-09 60 33 2 115 3 arfA Peptidoglycan-binding protein ArfA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1KH31 5.03e-09 60 33 2 115 1 arfA Peptidoglycan-binding protein ArfA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P65594 5.03e-09 60 33 2 115 3 arfA Peptidoglycan-binding protein ArfA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q7NFT5 5.09e-09 61 31 4 141 1 psaB Photosystem I P700 chlorophyll a apoprotein A2 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q9I4L6 3.71e-08 55 34 1 96 1 yfiB Outer-membrane lipoprotein YfiB Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P37726 5.08e-08 57 35 2 116 1 oprF Outer membrane porin F Pseudomonas fluorescens
P0A3S8 9.41e-08 54 30 2 92 1 pal Peptidoglycan-associated lipoprotein Brucella suis biovar 1 (strain 1330)
P0A3S7 9.41e-08 54 30 2 92 1 pal Peptidoglycan-associated lipoprotein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0A3S9 9.41e-08 54 30 2 92 1 pal Peptidoglycan-associated lipoprotein Brucella abortus biovar 1 (strain 9-941)
Q9S3R9 2.44e-07 55 33 3 106 1 PG_0695 Outer membrane protein 41 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q98F85 1.77e-06 50 29 4 119 3 pal Peptidoglycan-associated lipoprotein Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9I4Z4 2.18e-06 50 31 3 112 3 pal Peptidoglycan-associated lipoprotein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q51886 2.26e-06 50 36 1 85 3 pal Peptidoglycan-associated lipoprotein Pasteurella multocida (strain Pm70)
P0A139 3.34e-06 50 33 4 112 3 pal Peptidoglycan-associated lipoprotein Pseudomonas putida
P0A138 3.34e-06 50 33 4 112 3 pal Peptidoglycan-associated lipoprotein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q926C3 3.63e-06 50 32 4 109 3 pal Peptidoglycan-associated lipoprotein Rhizobium meliloti (strain 1021)
P22263 6.71e-06 51 30 4 137 3 oprF Outer membrane porin F Pseudomonas syringae pv. syringae
Q6RYW5 1.46e-05 50 27 16 339 1 omp38 Outer membrane protein Omp38 Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
P10324 2.58e-05 47 36 2 86 1 pal Peptidoglycan-associated lipoprotein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P07021 2.77e-05 47 31 3 119 3 yfiB Putative lipoprotein YfiB Escherichia coli (strain K12)
A3M8K2 4.66e-05 48 27 16 339 3 omp38 Outer membrane protein Omp38 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
P80444 6.07e-05 42 80 0 21 1 ompA Outer membrane protein A (Fragment) Actinobacillus lignieresii
Q89AJ5 6.15e-05 46 33 3 103 3 pal Peptidoglycan-associated lipoprotein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P84838 8.65e-05 47 28 3 121 1 GDI2185 Outer membrane protein Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
P26493 0.000119 45 32 1 84 3 pal Peptidoglycan-associated lipoprotein Legionella pneumophila
Q8U9L5 0.00028 44 29 4 109 3 pal Peptidoglycan-associated lipoprotein Agrobacterium fabrum (strain C58 / ATCC 33970)
P0A914 0.000315 44 34 2 85 3 pal Peptidoglycan-associated lipoprotein Shigella flexneri
P0A912 0.000315 44 34 2 85 1 pal Peptidoglycan-associated lipoprotein Escherichia coli (strain K12)
P0A913 0.000315 44 34 2 85 3 pal Peptidoglycan-associated lipoprotein Escherichia coli O157:H7
Q9S3P9 0.000561 45 38 0 55 3 motY Sodium-type flagellar protein MotY Vibrio anguillarum

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03630
Feature type CDS
Gene ompA
Product porin OmpA
Location 32956 - 34029 (strand: 1)
Length 1074 (nucleotides) / 357 (amino acids)

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_185
Orthogroup size 9
N. genomes 7

Actions

Genomic region

Domains

PF00691 OmpA family
PF01389 OmpA-like transmembrane domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2885 Cell wall/membrane/envelope biogenesis (M) M Outer membrane protein OmpA and related peptidoglycan-associated (lipo)proteins

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03286 OmpA-OmpF porin, OOP family - -

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG043544 porin OmpA VF1158 Adherence

Protein Sequence

MKKTAIAVAVAVAAFASVAQAAPKDNTWYTGGKLGWSQYQNTGTGFDGESLGNTGPVHKDQLGAGIYAGYQHNQYMGFELGYDWLGRMPYKGDGNNGAFKAQGVQLTTKLSYPVMDDLDVYTRLGAMVWRADATASYNGERIKDNDTGVSPLFALGTEYAITRDIAARVEYQWINNIGDKETTMARPDNGMLSVGVAYRFGQDEVAAPVAEPAPVVAPVVENKRFTLRSDVLFNFNKSTLKAEGQEALNQLFNELASIDPTQGNVLVIGYTDRIGSQNYNLPLSQKRAQSVVDYLVAKGIPAGSIRAEGRGKEDPVTGNKCDNIKQRAALIECLAPDRRVEIEIQGVTEQVSQQAAQ

Flanking regions ( +/- flanking 50bp)

ATAATAAGGCTATTAAGCCAGAGCCAATTTGGATGATAACGAGGCGTAAAATGAAAAAGACAGCTATCGCAGTAGCAGTGGCAGTGGCAGCTTTCGCAAGCGTTGCGCAGGCAGCTCCAAAAGACAATACCTGGTATACCGGTGGTAAATTAGGTTGGTCTCAGTATCAGAACACCGGTACTGGTTTTGACGGTGAAAGCTTAGGCAACACTGGTCCGGTTCATAAAGATCAGCTCGGCGCTGGTATCTATGCTGGTTATCAGCACAACCAGTACATGGGCTTTGAATTAGGTTATGACTGGTTAGGTCGTATGCCTTACAAAGGCGACGGTAACAACGGCGCATTCAAAGCACAGGGCGTTCAGCTGACTACCAAACTGAGCTATCCGGTAATGGATGACTTAGACGTTTATACCCGTCTGGGTGCAATGGTATGGCGTGCAGACGCAACCGCATCTTACAACGGTGAGCGTATCAAAGATAACGACACTGGCGTTTCTCCGCTGTTCGCACTGGGTACTGAGTATGCAATCACCCGTGATATCGCAGCTCGCGTAGAATATCAGTGGATCAACAACATCGGCGATAAAGAAACCACCATGGCACGTCCTGATAACGGCATGCTGAGTGTTGGTGTTGCTTACCGTTTCGGCCAGGATGAAGTTGCTGCACCAGTTGCAGAACCAGCTCCGGTTGTTGCACCAGTTGTTGAGAACAAACGTTTCACCCTGCGTTCAGACGTTCTGTTCAACTTCAACAAATCTACTCTGAAAGCTGAAGGTCAGGAAGCTCTGAACCAGCTGTTCAACGAACTGGCGTCAATCGACCCGACTCAGGGCAACGTCCTGGTTATCGGTTACACTGACCGCATCGGTTCCCAGAACTACAACCTGCCACTGTCTCAGAAACGTGCACAGAGCGTTGTAGATTACCTGGTCGCTAAAGGCATCCCGGCCGGCAGCATCCGTGCAGAAGGCCGCGGTAAAGAAGATCCTGTTACTGGCAACAAATGTGACAATATCAAACAGCGCGCTGCTCTGATCGAATGTCTGGCACCAGACCGTCGTGTTGAAATCGAAATCCAGGGTGTAACTGAACAAGTCTCTCAGCAGGCTGCTCAGTAAGTTCTGAATTCGGTTGTATGATGCGATTCGATTGCACAATGCAATGAATT