Homologs in group_1325

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07385 FBDBKF_07385 100.0 Morganella morganii S1 tusE sulfurtransferase TusE
NLDBIP_03585 NLDBIP_03585 100.0 Morganella morganii S4 tusE sulfurtransferase TusE
LHKJJB_09415 LHKJJB_09415 100.0 Morganella morganii S3 tusE sulfurtransferase TusE
HKOGLL_09560 HKOGLL_09560 100.0 Morganella morganii S5 tusE sulfurtransferase TusE
F4V73_RS01575 F4V73_RS01575 91.7 Morganella psychrotolerans - TusE/DsrC/DsvC family sulfur relay protein
PMI_RS03900 PMI_RS03900 81.7 Proteus mirabilis HI4320 tusE sulfurtransferase TusE

Distribution of the homologs in the orthogroup group_1325

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1325

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N5Z1 3.69e-63 190 81 0 109 3 tusE Sulfurtransferase TusE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8ZG65 6.42e-61 184 79 0 109 3 tusE Sulfurtransferase TusE Yersinia pestis
Q6D6C3 1.69e-60 183 77 0 109 3 tusE Sulfurtransferase TusE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q66CD8 1.95e-60 183 81 0 106 3 tusE Sulfurtransferase TusE Yersinia pseudotuberculosis serotype I (strain IP32953)
Q32HT7 2.77e-57 175 71 0 109 3 tusE Sulfurtransferase TusE Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z3F2 1.29e-56 173 71 0 109 3 tusE Sulfurtransferase TusE Shigella sonnei (strain Ss046)
P0AB19 1.29e-56 173 71 0 109 3 tusE Sulfurtransferase TusE Shigella flexneri
Q31YN2 1.29e-56 173 71 0 109 3 tusE Sulfurtransferase TusE Shigella boydii serotype 4 (strain Sb227)
P0AB18 1.29e-56 173 71 0 109 1 tusE Sulfurtransferase TusE Escherichia coli (strain K12)
Q8XD82 1.29e-56 173 71 0 109 3 tusE Sulfurtransferase TusE Escherichia coli O157:H7
Q7CQS8 2.54e-56 172 70 0 109 3 tusE Sulfurtransferase TusE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEZ7 2.54e-56 172 70 0 109 3 tusE Sulfurtransferase TusE Salmonella typhi
Q5PGB9 2.54e-56 172 70 0 109 3 tusE Sulfurtransferase TusE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q8FJ69 2.54e-56 172 71 0 109 3 tusE Sulfurtransferase TusE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q57QR9 1.36e-55 171 69 0 109 3 tusE Sulfurtransferase TusE Salmonella choleraesuis (strain SC-B67)
Q2NU63 1.53e-53 166 68 0 106 3 tusE Sulfurtransferase TusE Sodalis glossinidius (strain morsitans)
P45184 8.26e-47 149 63 0 109 3 tusE Sulfurtransferase TusE homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P57539 9.66e-38 125 49 1 109 3 tusE Sulfurtransferase TusE Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K998 2e-36 122 50 0 102 3 tusE Sulfurtransferase TusE Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AA8 3.15e-28 101 47 1 91 3 tusE Sulfurtransferase TusE Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P45573 7.55e-18 75 35 2 108 1 dsvC Sulfite reductase, dissimilatory-type subunit gamma Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03585
Feature type CDS
Gene tusE
Product sulfurtransferase TusE
Location 24557 - 24886 (strand: 1)
Length 330 (nucleotides) / 109 (amino acids)
In genomic island -

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1325
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04358 DsrC like protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2920 Translation, ribosomal structure and biogenesis (J) J Sulfur transfer complex TusBCD TusE component, DsrC family (tRNA 2-thiouridine synthesizing protein C)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K11179 tRNA 2-thiouridine synthesizing protein E [EC:2.8.1.-] Sulfur relay system -

Protein Sequence

MFVFEGREIATDPHGYLLNVQDWQEAMVPLLAEQEEITLTEQHWEVIRFVRDFYLEFNTSPAIRMLVKAITQKYGEERGNSRYLYRLFPKGPAKQATKLAGLPKPVKCI

Flanking regions ( +/- flanking 50bp)

GCGGCAGATTTTTGCTACATTTTCATTCTCATTTTCAGCAGGTTCAGATTATGTTTGTGTTTGAAGGGCGTGAAATCGCCACTGACCCCCACGGCTATTTACTCAATGTGCAGGACTGGCAGGAAGCAATGGTGCCGCTGCTGGCTGAACAGGAAGAAATCACCCTGACAGAACAGCACTGGGAAGTTATCCGCTTTGTGCGGGATTTTTATCTGGAATTTAATACCTCACCGGCTATCCGCATGCTGGTGAAAGCCATCACACAGAAGTATGGCGAGGAGCGCGGGAACAGTCGTTATCTGTACCGCCTGTTTCCGAAAGGCCCGGCCAAACAGGCAACAAAGCTGGCCGGTCTGCCGAAACCGGTGAAATGTATCTGACCGCCGTTTATTCGTGGCGGACACGGAATACCGCAACTTCCCTGTAATCA