Homologs in group_2443

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_20070 FBDBKF_20070 100.0 Morganella morganii S1 - HTH cro/C1-type domain-containing protein
NLDBIP_03460 NLDBIP_03460 100.0 Morganella morganii S4 - HTH cro/C1-type domain-containing protein
LHKJJB_09290 LHKJJB_09290 100.0 Morganella morganii S3 - HTH cro/C1-type domain-containing protein
HKOGLL_09685 HKOGLL_09685 100.0 Morganella morganii S5 - HTH cro/C1-type domain-containing protein
F4V73_RS01690 F4V73_RS01690 85.9 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
PMI_RS10875 PMI_RS10875 44.2 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_2443

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2443

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8TZX4 9.35e-06 44 35 0 60 3 PF1851 Putative HTH-type transcriptional regulatory protein PF1851 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P15017 1.04e-05 43 30 0 72 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P0C5S2 2.29e-05 42 37 0 62 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 2.29e-05 42 37 0 62 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
O59472 3.55e-05 43 35 0 60 3 PH1808 Putative HTH-type transcriptional regulatory protein PH1808 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P06966 4.41e-05 42 38 1 70 4 dicA HTH-type transcriptional regulator DicA Escherichia coli (strain K12)
Q8ZWT6 8.73e-05 42 44 0 45 3 PAE1627 Putative HTH-type transcriptional regulatory protein PAE1627 Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2)
P55409 0.000466 38 33 0 65 4 NGR_a04070 Uncharacterized HTH-type transcriptional regulator y4dJ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P55681 0.00053 39 33 0 69 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_03460
Feature type CDS
Gene -
Product HTH cro/C1-type domain-containing protein
Location 706 - 942 (strand: 1)
Length 237 (nucleotides) / 78 (amino acids)

Contig

Accession ZDB_214
Length 335585 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2443
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MMNINKIVGEQIRAHRKEQGLSGSELGDKLKLSQQQVSRYERGECNIPLDMLFTISLVLEVPFVKLFGDLNNSRDYTF

Flanking regions ( +/- flanking 50bp)

ACCTTGCATATTATTCCCATAAGAAACCCGGTAATTTTTGAGTACGACTCATGATGAATATAAATAAAATTGTTGGAGAACAAATCAGAGCACACAGAAAAGAACAGGGATTATCCGGTTCAGAATTAGGTGACAAATTAAAATTAAGTCAGCAGCAGGTTTCACGCTATGAGCGCGGGGAATGCAATATTCCGCTTGATATGCTGTTTACTATTTCACTTGTTCTGGAAGTGCCTTTTGTAAAGCTGTTTGGTGATCTTAACAACAGCCGGGATTATACGTTTTAATTTTAGCATTTTACGTTTTTTCATTTCTGATACACACAACACTCAAATTG