Homologs in group_498

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_00925 FBDBKF_00925 100.0 Morganella morganii S1 araC AraC-type DNA-binding domain and AraC-containing proteins
NLDBIP_02840 NLDBIP_02840 100.0 Morganella morganii S4 araC AraC-type DNA-binding domain and AraC-containing proteins
LHKJJB_04355 LHKJJB_04355 100.0 Morganella morganii S3 araC AraC-type DNA-binding domain and AraC-containing proteins
HKOGLL_02690 HKOGLL_02690 100.0 Morganella morganii S5 araC AraC-type DNA-binding domain and AraC-containing proteins
F4V73_RS06920 F4V73_RS06920 80.3 Morganella psychrotolerans - AraC family transcriptional regulator
PMI_RS05015 PMI_RS05015 33.5 Proteus mirabilis HI4320 - AraC family transcriptional regulator

Distribution of the homologs in the orthogroup group_498

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_498

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9WW32 6.36e-13 70 30 1 107 1 mtrA HTH-type transcriptional regulator MtrA Neisseria gonorrhoeae
Q1R414 6.08e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain UTI89 / UPEC)
B7NFK3 6.08e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A1AI82 6.08e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O1:K1 / APEC
B7NUA1 6.08e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MI37 6.08e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZUB7 6.69e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O139:H28 (strain E24377A / ETEC)
B1LMU6 6.89e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SMS-3-5 / SECEC)
B5XZ49 6.96e-10 61 36 0 80 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae (strain 342)
B7N2P7 6.96e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O81 (strain ED1a)
Q0TAF8 7.3e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UNM6 7.3e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q8CXW5 7.44e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q31U84 7.73e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 4 (strain Sb227)
P09377 7.73e-10 61 37 0 78 1 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12)
B1IVH3 7.73e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A709 7.73e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O9:H4 (strain HS)
B1XB72 7.73e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / DH10B)
C5A073 7.73e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain K12 / MC4100 / BW2952)
B7M6V7 7.73e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O8 (strain IAI1)
B7L9G1 7.73e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain 55989 / EAEC)
B6I4P8 7.81e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli (strain SE11)
Q32A70 7.96e-10 61 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Shigella dysenteriae serotype 1 (strain Sd197)
Q3YV71 8.77e-10 60 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Shigella sonnei (strain Ss046)
Q83PE0 1.06e-09 60 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri
Q0SZ95 1.06e-09 60 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Shigella flexneri serotype 5b (strain 8401)
A6TGA9 1.15e-09 60 36 0 80 3 rhaS HTH-type transcriptional activator RhaS Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
O31249 1.23e-09 60 31 0 91 4 alkR HTH-type transcriptional regulator AlkR Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q51872 1.43e-09 60 25 6 242 4 lumQ Probable transcriptional regulator LumQ Photobacterium leiognathi
A4WG91 1.89e-09 60 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Enterobacter sp. (strain 638)
B5BJG8 3.36e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain AKU_12601)
Q5PKG2 3.36e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57HG8 3.42e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella choleraesuis (strain SC-B67)
B5F0M9 3.46e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella agona (strain SL483)
P0A2S9 3.56e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2T0 3.56e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella typhi
C0Q3L4 3.56e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi C (strain RKS4594)
A9MZC8 3.56e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SZZ3 3.56e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella newport (strain SL254)
B5RFC3 3.56e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QWY4 3.56e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella enteritidis PT4 (strain P125109)
B4TPQ9 3.59e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella schwarzengrund (strain CVM19633)
B4TBY3 3.66e-09 59 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella heidelberg (strain SL476)
A9MI64 3.95e-09 58 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B2TVP7 4.43e-09 58 35 0 78 3 rhaS HTH-type transcriptional activator RhaS Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B5YZ43 4.43e-09 58 35 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X897 4.43e-09 58 35 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia coli O157:H7
Q03320 4.72e-09 58 30 3 156 4 None Putative AraC-like transcription regulator Streptomyces antibioticus
B7LVD8 5.12e-09 58 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5FPP5 5.22e-09 58 37 0 78 3 rhaS HTH-type transcriptional activator RhaS Salmonella dublin (strain CT_02021853)
A9QYR8 8.63e-09 58 35 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Angola)
B1JNC5 8.96e-09 58 35 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TRS8 8.96e-09 58 35 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis (strain Pestoides F)
B2K1W5 8.96e-09 58 35 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FN80 8.96e-09 58 35 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q66FF2 9.49e-09 57 35 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pseudotuberculosis serotype I (strain IP32953)
A8AL27 1.02e-08 57 35 0 78 3 rhaS HTH-type transcriptional activator RhaS Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P77379 1.16e-08 57 32 0 98 1 rclR RCS-specific HTH-type transcriptional activator RclR Escherichia coli (strain K12)
Q65Q31 1.24e-08 57 23 2 163 3 rhaS HTH-type transcriptional activator RhaS Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
G3XCU2 3.13e-08 56 29 0 94 4 argR HTH-type transcriptional regulator ArgR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P45008 3.99e-08 56 23 4 219 4 HI_1052 Uncharacterized HTH-type transcriptional regulator HI_1052 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P35319 4.09e-08 56 36 0 87 4 None Putative AraC-like transcription regulator Streptomyces lividans
P28808 4.52e-08 55 29 0 86 4 lcrF Thermoregulatory protein LcrF Yersinia pestis
Q1CEB5 4.98e-08 55 34 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJ00 4.98e-08 55 34 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis
Q1C0W1 4.98e-08 55 34 0 79 3 rhaS HTH-type transcriptional activator RhaS Yersinia pestis bv. Antiqua (strain Antiqua)
P0C2V5 5.11e-08 55 29 0 86 2 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica
A1JU91 5.46e-08 55 29 0 86 3 virF Virulence regulon transcriptional activator VirF Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
O87389 7.71e-08 55 29 0 119 4 glxA HTH-type transcriptional regulator GlxA Rhizobium meliloti (strain 1021)
P17410 1.33e-07 54 25 9 241 1 chbR HTH-type transcriptional regulator ChbR Escherichia coli (strain K12)
Q8FCI6 1.96e-07 53 30 2 104 3 gadX HTH-type transcriptional regulator GadX Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9EYV5 2.11e-07 53 30 2 104 3 gadX HTH-type transcriptional regulator GadX Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P26993 4.37e-07 53 27 0 86 1 exsA HTH-type transcriptional regulator ExsA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q6NI56 9.38e-07 52 35 1 94 3 ripA HTH-type transcriptional regulator RipA Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
P76135 2.36e-06 50 28 2 87 2 ydeO HTH-type transcriptional regulator YdeO Escherichia coli (strain K12)
Q83PR0 2.39e-06 50 29 2 104 3 gadX HTH-type transcriptional regulator GadX Shigella flexneri
P37639 2.53e-06 50 29 2 104 1 gadX HTH-type transcriptional regulator GadX Escherichia coli (strain K12)
P58230 2.6e-06 50 29 2 104 3 gadX HTH-type transcriptional regulator GadX Escherichia coli O157:H7
B4TPR0 3.01e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella schwarzengrund (strain CVM19633)
A9MI63 3.27e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F0N0 3.3e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella agona (strain SL483)
P40865 3.46e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B5BJG9 3.46e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain AKU_12601)
A9MZC9 3.46e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKG1 3.46e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZZ4 3.46e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella newport (strain SL254)
B5QWY5 3.46e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella enteritidis PT4 (strain P125109)
B5FPP6 3.66e-06 50 32 0 71 3 rhaR HTH-type transcriptional activator RhaR Salmonella dublin (strain CT_02021853)
Q8Z2V5 4.37e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella typhi
B4TBY4 4.37e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella heidelberg (strain SL476)
Q57HG7 4.41e-06 50 27 0 98 3 rhaR HTH-type transcriptional activator RhaR Salmonella choleraesuis (strain SC-B67)
Q8FQS2 5.17e-06 50 34 1 99 3 ripA HTH-type transcriptional regulator RipA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q00753 6.13e-06 49 24 0 81 4 msmR Msm operon regulatory protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P33234 7.01e-06 49 31 1 79 2 adiY HTH-type transcriptional regulator AdiY Escherichia coli (strain K12)
Q46855 9.38e-06 49 25 1 97 4 yqhC Uncharacterized HTH-type transcriptional regulator YqhC Escherichia coli (strain K12)
P05052 2.07e-05 47 27 2 99 1 appY HTH-type transcriptional regulator AppY Escherichia coli (strain K12)
A4WG90 2.16e-05 48 32 0 71 3 rhaR HTH-type transcriptional activator RhaR Enterobacter sp. (strain 638)
P0ACI3 2.46e-05 48 28 0 81 1 xylR Xylose operon regulatory protein Escherichia coli (strain K12)
P0ACI4 2.46e-05 48 28 0 81 3 xylR Xylose operon regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI5 2.46e-05 48 28 0 81 3 xylR Xylose operon regulatory protein Escherichia coli O157:H7
Q02458 2.63e-05 47 28 1 95 1 ureR Urease operon transcriptional activator Proteus mirabilis (strain HI4320)
A7ML57 2.79e-05 47 28 0 90 3 rhaR HTH-type transcriptional activator RhaR Cronobacter sakazakii (strain ATCC BAA-894)
Q8NRR3 2.95e-05 47 32 1 99 2 ripA HTH-type transcriptional regulator RipA Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8X4Z9 3.26e-05 47 29 2 81 3 Z2209 HTH-type transcriptional regulator YdeO Escherichia coli O157:H7
Q83RF4 3.51e-05 47 29 2 81 3 ydeO HTH-type transcriptional regulator YdeO Shigella flexneri
P31449 3.58e-05 47 26 2 137 4 yidL Uncharacterized HTH-type transcriptional regulator YidL Escherichia coli (strain K12)
Q8FHG0 3.61e-05 47 29 2 81 3 ydeO HTH-type transcriptional regulator YdeO Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q65Q30 3.76e-05 47 35 1 78 3 rhaR HTH-type transcriptional activator RhaR Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P77634 7.37e-05 46 34 1 91 4 ybcM Uncharacterized HTH-type transcriptional regulator YbcM Escherichia coli (strain K12)
P0CL08 0.000109 46 25 4 122 4 hilD Transcriptional regulator HilD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WAC0 0.000109 46 25 4 122 4 hilD Transcriptional regulator HilD Salmonella typhimurium (strain SL1344)
P32326 0.000118 45 25 1 97 4 ureR Urease operon transcriptional activator Escherichia coli
P09378 0.000124 45 25 0 98 1 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12)
A8A710 0.000124 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O9:H4 (strain HS)
C5A074 0.000124 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain K12 / MC4100 / BW2952)
Q1R413 0.000126 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli (strain UTI89 / UPEC)
A1AI83 0.000126 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O1:K1 / APEC
Q8X7B3 0.000127 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O157:H7
Q83PD9 0.000132 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri
Q0SZ96 0.000132 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Shigella flexneri serotype 5b (strain 8401)
Q31U83 0.000133 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Shigella boydii serotype 4 (strain Sb227)
Q8FBD7 0.000133 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAF7 0.000133 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZUB8 0.000133 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Escherichia coli O139:H28 (strain E24377A / ETEC)
Q32A71 0.000137 45 25 0 98 3 rhaR HTH-type transcriptional activator RhaR Shigella dysenteriae serotype 1 (strain Sd197)
P40883 0.000196 45 27 1 98 2 pchR Regulatory protein PchR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9HTH5 0.000547 43 24 0 104 1 cdhR HTH-type transcriptional regulator CdhR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8Z4A6 0.000564 43 29 1 82 3 sirC Transcriptional regulator SirC Salmonella typhi
P0CL09 0.000574 43 29 1 82 4 sirC Transcriptional regulator sirC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WAB2 0.000574 43 29 1 82 3 sirC Transcriptional regulator SirC Salmonella typhimurium (strain SL1344)
T2KMF4 0.000578 44 28 0 70 3 BN863_21930 Histidine kinase P4 Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_00620
Feature type CDS
Gene araC
Product AraC-type DNA-binding domain and AraC-containing proteins
Location 138388 - 139107 (strand: 1)
Length 720 (nucleotides) / 239 (amino acids)

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_498
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF12833 Helix-turn-helix domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG4977 Transcription (K) K Transcriptional regulator GlxA, contains an amidase domain and an AraC-type DNA-binding HTH domain

Protein Sequence

MKRPVISLRTYRQETLEHSHDDMWQLVLGGSGAMELTVGSDSGSVEQGRMAAIPPGYHHRFCGTGHNRQVVLELPADSLFFTSPDSLWSVLPDATRAYVDWLISYPQMIEQHPESARILLAEQLAAQLQPDGQDRRWLHTLTQQLTARPDYPWTVSEMASCCALSASTLQRRLLAATGKTPAVFLTEIRLRRAHHLICHTPLTLPEIALRCGYSTQSSLTSAFRRFYGDTPASLRIKKG

Flanking regions ( +/- flanking 50bp)

GATGTAACACCCTGCCGCCTGTCGTTTTCAGTACTCTCAGGGGGTATTCCATGAAACGACCTGTTATCTCATTACGTACCTACCGGCAGGAAACCCTGGAGCACAGTCATGATGACATGTGGCAACTGGTGCTGGGCGGCAGCGGCGCAATGGAACTGACTGTCGGCAGCGACAGCGGTTCGGTGGAGCAGGGACGGATGGCGGCGATCCCGCCGGGGTATCACCACCGTTTCTGCGGCACCGGTCATAACCGCCAGGTGGTACTTGAACTGCCTGCGGACAGCCTCTTCTTCACTTCCCCTGATTCTCTGTGGTCTGTGCTGCCGGATGCCACCCGTGCTTATGTGGACTGGCTTATCAGTTATCCGCAGATGATTGAACAGCATCCGGAAAGTGCGCGTATTCTGCTGGCAGAGCAGCTTGCGGCGCAACTGCAGCCGGACGGGCAGGACAGGCGCTGGCTGCATACTCTGACACAACAGCTGACCGCGCGTCCTGATTACCCGTGGACGGTCAGTGAAATGGCGTCGTGCTGTGCATTATCGGCCAGTACTCTTCAGCGTCGTCTGCTGGCGGCCACCGGTAAAACCCCGGCGGTTTTTCTGACAGAAATACGCCTGCGCCGGGCACATCATCTTATCTGCCATACTCCGCTGACACTGCCGGAAATTGCCCTGCGCTGTGGTTACAGTACTCAATCTTCCCTGACCAGTGCTTTCCGCCGCTTTTACGGCGATACACCGGCCAGCCTGCGCATAAAAAAAGGGTGAGCCGGAGCTCACCCTTTTTGCTTTTGTACACTATTTCAATCAGGCAGATT