Homologs in group_598

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01110 FBDBKF_01110 100.0 Morganella morganii S1 fdx ISC system 2Fe-2S type ferredoxin
NLDBIP_03025 NLDBIP_03025 100.0 Morganella morganii S4 fdx ISC system 2Fe-2S type ferredoxin
LHKJJB_04540 LHKJJB_04540 100.0 Morganella morganii S3 fdx ISC system 2Fe-2S type ferredoxin
HKOGLL_02505 HKOGLL_02505 100.0 Morganella morganii S5 fdx ISC system 2Fe-2S type ferredoxin
F4V73_RS07180 F4V73_RS07180 93.7 Morganella psychrotolerans fdx ISC system 2Fe-2S type ferredoxin
PMI_RS09155 PMI_RS09155 91.9 Proteus mirabilis HI4320 fdx ISC system 2Fe-2S type ferredoxin

Distribution of the homologs in the orthogroup group_598

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_598

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9R6 1.03e-68 204 87 0 111 3 fdx 2Fe-2S ferredoxin Shigella flexneri
P0A9R4 1.03e-68 204 87 0 111 1 fdx 2Fe-2S ferredoxin Escherichia coli (strain K12)
P0A9R5 1.03e-68 204 87 0 111 3 fdx 2Fe-2S ferredoxin Escherichia coli O157:H7
Q51383 1.13e-59 181 80 0 110 3 fdx 2Fe-2S ferredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P44428 7.06e-52 161 68 0 110 3 fdx 2Fe-2S ferredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q89A15 6.39e-46 146 61 0 107 3 fdx 2Fe-2S ferredoxin Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O51882 8.61e-46 146 60 0 111 3 fdx 2Fe-2S ferredoxin Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57661 3.1e-45 145 59 0 111 3 fdx 2Fe-2S ferredoxin Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8SV19 1.14e-18 78 40 3 109 1 ECU07_0600 Adrenodoxin homolog Encephalitozoon cuniculi (strain GB-M1)
Q12184 2.51e-17 75 44 2 92 1 YAH1 Adrenodoxin homolog, mitochondrial Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P37098 4.47e-16 70 40 5 108 3 fdxB 2Fe-2S ferredoxin Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q92J08 1.99e-15 69 41 3 107 3 fdxB 2Fe-2S ferredoxin Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9AKM6 5.05e-15 68 40 3 107 3 fdxB 2Fe-2S ferredoxin Rickettsia montanensis
Q9AKH1 7.62e-15 67 40 3 107 3 fdxB 2Fe-2S ferredoxin Rickettsia rickettsii
Q9AKC4 9.08e-15 67 39 3 107 3 fdxB 2Fe-2S ferredoxin Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UKL2 1.56e-14 67 39 3 107 3 fdxB 2Fe-2S ferredoxin Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
P37193 1.56e-14 68 46 2 86 2 Fdx1 Adrenodoxin-like protein 1, mitochondrial Drosophila melanogaster
Q9ZDW6 1.68e-14 67 39 3 107 3 fdxB 2Fe-2S ferredoxin Rickettsia prowazekii (strain Madrid E)
Q08C57 2.32e-14 68 44 2 89 2 fdx2 Ferredoxin-2, mitochondrial Danio rerio
Q8S904 6.84e-14 67 46 2 89 2 MFDX2 Adrenodoxin-like protein 2, mitochondrial Arabidopsis thaliana
Q9M0V0 2.09e-13 66 44 2 89 1 MFDX1 Adrenodoxin-like protein 1, mitochondrial Arabidopsis thaliana
Q9CPW2 4.03e-13 65 46 2 86 1 Fdx2 Ferredoxin-2, mitochondrial Mus musculus
Q5FWQ0 1.05e-12 64 48 2 86 2 fdx2 Ferredoxin-2, mitochondrial Xenopus laevis
Q1RJ69 1.69e-12 62 41 3 107 3 fdxB 2Fe-2S ferredoxin Rickettsia bellii (strain RML369-C)
P00257 2.57e-12 63 37 5 106 1 FDX1 Adrenodoxin, mitochondrial Bos taurus
P29330 3.42e-12 61 37 5 106 1 FDX1 Adrenodoxin Ovis aries
Q6P4F2 4.37e-12 62 45 2 86 1 FDX2 Ferredoxin-2, mitochondrial Homo sapiens
Q05B51 7.18e-12 62 45 2 86 2 FDX2 Ferredoxin-2, mitochondrial Bos taurus
P00258 2.57e-11 60 37 5 106 1 FDX1 Adrenodoxin, mitochondrial Sus scrofa
P10109 2.77e-11 60 36 5 106 1 FDX1 Adrenodoxin, mitochondrial Homo sapiens
P59799 5.97e-11 57 34 4 103 1 fdx5 2Fe-2S ferredoxin-5 Aquifex aeolicus (strain VF5)
P24483 6.8e-11 59 38 4 97 2 Fdx1 Adrenodoxin, mitochondrial Rattus norvegicus
P13216 7.66e-11 58 39 4 92 1 FDX1 Adrenodoxin, mitochondrial (Fragment) Gallus gallus
P80306 8.76e-11 57 36 5 110 1 fdxE Ferredoxin-6 Rhodobacter capsulatus
P46656 1.21e-10 58 37 4 97 1 Fdx1 Adrenodoxin, mitochondrial Mus musculus
Q10361 2.92e-10 58 47 2 71 1 etp1 Heme A synthase-mitochondrial ferredoxin fusion protein Schizosaccharomyces pombe (strain 972 / ATCC 24843)
D5IGG4 6.01e-10 55 42 2 75 1 carAc Ferredoxin CarAc Sphingomonas sp.
Q8SZA8 1.38e-09 55 40 5 92 2 Fdx2 Adrenodoxin-like protein 2, mitochondrial Drosophila melanogaster
X5CWH9 1.72e-09 53 37 3 96 1 cndB2 Chloroacetanilide N-alkylformylase 2, ferredoxin component Rhizorhabdus wittichii (strain DC-6 / KACC 16600)
P00259 7.23e-09 52 35 5 106 1 camB Putidaredoxin Pseudomonas putida
P33007 1.47e-08 51 33 6 106 1 terPB Terpredoxin Pseudomonas sp.
Q5S3I4 6.5e-07 47 35 3 94 1 ddmB Dicamba O-demethylase, ferredoxin component Stenotrophomonas maltophilia
P23101 1.17e-06 48 39 4 82 3 xylZ Toluate 1,2-dioxygenase electron transfer component Pseudomonas putida
P76081 4.99e-06 47 38 2 77 1 paaE 1,2-phenylacetyl-CoA epoxidase, subunit E Escherichia coli (strain K12)
W8X5L3 4.79e-05 42 36 2 72 1 ctmE 2Fe-2S ferredoxin CtmE Castellaniella defragrans (strain DSM 12143 / CCUG 39792 / 65Phen)
X5CFH4 5.59e-05 42 34 3 95 1 cndB1 Chloroacetanilide N-alkylformylase 1, ferredoxin component Rhizorhabdus wittichii (strain DC-6 / KACC 16600)
Q7WTJ2 0.000145 42 34 3 88 1 mphP Phenol hydroxylase P5 protein Acinetobacter pittii (strain PHEA-2)
P19734 0.000272 42 35 5 88 1 dmpP Phenol 2-monooxygenase, reductase component DmpP Pseudomonas sp. (strain CF600)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_00435
Feature type CDS
Gene fdx
Product ISC system 2Fe-2S type ferredoxin
Location 101376 - 101711 (strand: 1)
Length 336 (nucleotides) / 111 (amino acids)
In genomic island -

Contig

Accession ZDB_213
Length 680219 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_598
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00111 2Fe-2S iron-sulfur cluster binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0633 Energy production and conversion (C) C Ferredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04755 ferredoxin, 2Fe-2S Benzoate degradation
Microbial metabolism in diverse environments
-

Protein Sequence

MPKIVFLPHESLCPEGAVYDANEGESILDVALRNGIEIEHACEKSCACTTCHCIVREGFDSLGESSELEDDMLDKAWGLEPESRLSCQAKVADEDLVVEIPKYTINHAREH

Flanking regions ( +/- flanking 50bp)

CCGCAAGGCACTCGCGGGCCACTCTGTGGATGAGATATAACGGGAAGATTATGCCTAAGATTGTTTTTTTACCGCATGAGTCATTATGCCCTGAAGGTGCGGTATACGACGCAAATGAAGGTGAGTCAATTCTGGATGTTGCCCTGCGTAACGGTATCGAAATTGAACATGCCTGTGAGAAATCATGTGCCTGCACAACCTGTCACTGTATCGTCCGCGAAGGGTTTGACTCCCTCGGAGAGAGCAGTGAGCTGGAAGATGACATGCTGGACAAAGCCTGGGGACTCGAGCCGGAAAGCCGTCTGAGCTGCCAGGCGAAAGTCGCGGATGAAGACCTGGTGGTGGAAATTCCGAAATACACCATCAACCACGCGCGTGAGCACTGATAAAGGAGCCTGAAATGGGACTGAAATGGCAGGACAGCCGTGAAATCGGC