Homologs in group_224

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_01385 FBDBKF_01385 33.9 Morganella morganii S1 - DUF1240 domain-containing protein
EHELCC_00160 EHELCC_00160 33.9 Morganella morganii S2 - DUF1240 domain-containing protein
NLDBIP_03300 NLDBIP_03300 33.9 Morganella morganii S4 - DUF1240 domain-containing protein
LHKJJB_04815 LHKJJB_04815 33.9 Morganella morganii S3 - DUF1240 domain-containing protein
HKOGLL_02230 HKOGLL_02230 33.9 Morganella morganii S5 - DUF1240 domain-containing protein
F4V73_RS10130 F4V73_RS10130 58.6 Morganella psychrotolerans - DUF1240 domain-containing protein
PMI_RS15225 PMI_RS15225 91.5 Proteus mirabilis HI4320 - DUF1240 domain-containing protein

Distribution of the homologs in the orthogroup group_224

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_224

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19695
Feature type CDS
Gene -
Product DUF1240 domain-containing protein
Location 3379767 - 3379946 (strand: -1)
Length 180 (nucleotides) / 59 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_224
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF06836 Protein of unknown function (DUF1240)

Protein Sequence

MNNKVAGICAGIAIIGIVFSFFFSIYVGLDLTSKGYYRCYKSSAFAPNEYVIAKEMCKK

Flanking regions ( +/- flanking 50bp)

TATTTCTCATATTATAGTTTTATTTTAGGATACCAAAAAAGTTACAAAGAATGAATAATAAAGTAGCTGGTATATGCGCAGGAATAGCAATAATTGGTATCGTTTTTAGCTTTTTCTTTTCAATTTATGTCGGTCTCGATTTAACCTCTAAAGGCTATTATCGTTGTTATAAATCATCTGCTTTTGCACCAAATGAATATGTTATTGCAAAAGAGATGTGTAAAAAATAGACATCTCTTAAATCTGATAATGTGTACTAATAGTTTTCATTGTCAGATAT