Homologs in group_3700

Help

2 homologs were identified in 2 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12795 FBDBKF_12795 82.8 Morganella morganii S1 - DUF1073 domain-containing protein
F4V73_RS06135 F4V73_RS06135 82.0 Morganella psychrotolerans - DUF1073 domain-containing protein

Distribution of the homologs in the orthogroup group_3700

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3700

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19545
Feature type CDS
Gene -
Product DUF1073 domain-containing protein
Location 902690 - 903058 (strand: 1)
Length 369 (nucleotides) / 122 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3700
Orthogroup size 3
N. genomes 3

Actions

Genomic region

Domains

PF06381 Anti-CBASS protein Acb1-like

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3567 Function unknown (S) S Uncharacterized conserved protein, DUF1073 domain

Protein Sequence

MTHQLKEQVHFGHVYGDRLALFVVETSNPKEWYENPFNIDGVTKGMYKGIKQIDPQWVTPDLTDANVQDPASMDFYEPTYYVIGGRKYHKSHFIKFVPFPVPNVLKPMYNYFGVSVPERIYE

Flanking regions ( +/- flanking 50bp)

GATGATCGTGCTATCAGTAAAAAGCATCGCAAACGAGATAAAAATACCGCATTACACATCAGCTTAAAGAGCAGGTTCACTTTGGGCATGTATACGGTGATCGTTTAGCATTATTCGTTGTGGAGACATCAAATCCGAAAGAGTGGTATGAAAACCCGTTTAATATCGATGGTGTGACCAAAGGCATGTACAAGGGGATTAAACAGATTGATCCACAATGGGTAACACCTGATTTAACGGACGCCAATGTTCAAGATCCTGCCAGCATGGATTTCTACGAACCAACCTATTATGTGATTGGTGGGCGCAAGTATCACAAATCTCACTTTATTAAGTTTGTACCGTTTCCTGTGCCGAATGTCTTGAAACCAATGTACAACTACTTTGGTGTTTCTGTTCCTGAGCGCATTTATGAGTGACACACTATGCAACGGCTGGAAGTAGCTACACAAAAGAGGAAAGTGACGGG