Homologs in group_4414

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4414

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4414

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19455
Feature type CDS
Gene -
Product hypothetical protein
Location 2184503 - 2184649 (strand: 1)
Length 147 (nucleotides) / 48 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4414
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG038915 conserved hypothetical protein in rtx gene loci VF0482 Exotoxin

Protein Sequence

MAINEKFVQEISSINYNNSIFSLYFVGQDPHKIAQGIMPEKDEELALK

Flanking regions ( +/- flanking 50bp)

AAATTATCGATTTATTCATTAAAATGATTAATTATATGGAGAAAGTCTTTATGGCAATTAACGAAAAATTTGTCCAAGAAATATCAAGCATTAATTATAATAATAGTATATTTTCACTCTATTTTGTCGGTCAAGATCCTCATAAAATAGCACAAGGTATCATGCCAGAAAAAGATGAAGAATTAGCCCTAAAGTAAGTGATCCACATTCCTGCTTCTGGTTTTATTTATATGGCTTCAATAATTAA