Homologs in group_3649

Help

4 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS18780 PMI_RS18780 48.9 Proteus mirabilis HI4320 - Hok/Gef family protein
PMI_RS19000 PMI_RS19000 66.0 Proteus mirabilis HI4320 - Hok/Gef family protein
PMI_RS19005 PMI_RS19005 66.0 Proteus mirabilis HI4320 - Hok/Gef family protein
PMI_RS19010 PMI_RS19010 66.0 Proteus mirabilis HI4320 - Hok/Gef family protein

Distribution of the homologs in the orthogroup group_3649

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3649

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P13970 1.82e-19 75 70 0 48 3 srnB Protein SrnB Escherichia coli (strain K12)
Q7UDF9 1.17e-09 50 47 0 48 3 hokE Protein HokE Shigella flexneri
Q8XBW9 1.17e-09 50 47 0 48 3 hokE Protein HokE Escherichia coli O157:H7
P11902 2.16e-09 49 53 0 41 2 pndA Protein PndA Escherichia coli
Q7UDG0 3.2e-09 49 47 0 48 3 hokF Putative protein HokF Shigella flexneri
P16477 4.16e-09 49 48 0 43 3 pndA Protein PndA Escherichia coli
P77091 5.3e-09 48 47 0 48 2 hokE Toxic protein HokE Escherichia coli (strain K12)
Q8XBX0 1.06e-08 48 45 0 48 3 hokF Putative protein HokF Escherichia coli O157:H7
Q8X7U9 1.74e-07 45 41 0 48 3 hokG Putative protein HokG Escherichia coli O157:H7
Q7UCD5 8.26e-05 38 40 0 44 3 hokD1 Protein HokD Shigella flexneri
P0ACG6 8.26e-05 38 40 0 44 3 hokD Toxic protein HokD Escherichia coli (strain K12)
P0ACG7 8.26e-05 38 40 0 44 3 hokD Protein HokD Escherichia coli O157:H7
P37305 0.000384 36 35 0 42 1 hokA Protein HokA Escherichia coli (strain K12)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS19185
Feature type CDS
Gene -
Product Hok/Gef family protein
Location 22605 - 22751 (strand: -1)
Length 147 (nucleotides) / 48 (amino acids)

Contig

Accession NC_010555
Length 36289 nucleotides
Topology circular
Plasmid True

Orthology

Orthogroup group_3649
Orthogroup size 5
N. genomes 1

Actions

Genomic region

Domains

PF01848 Hok/gef family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K18922 protein HokE - -

Protein Sequence

MTKYALIGLIAVCLTVLCFSLLMRDRLCSISVNSGNTVVQATLSYEER

Flanking regions ( +/- flanking 50bp)

CTACTTAGCACTAGAAATTGTGCCTCCTAATAAGTTAGGAGTCAAGGAAAATGACCAAGTACGCCCTGATAGGGCTGATTGCCGTTTGTTTAACGGTACTGTGTTTCTCTCTGTTAATGCGCGATAGACTCTGTTCTATCAGTGTGAATAGTGGGAATACAGTAGTTCAGGCAACACTTTCTTACGAAGAACGGTGATGCCTAGCGGGGGAGCATTCCCCCGCATTTTCTTTTTCTGTGTTTAGTTT