Homologs in group_4753
0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.
| Locus tag | Identity | Source | Gene | Product |
|---|
Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).
| Swissprot accession | Eval | Score | ID (%) | N gaps | Alignment length | Annot score | Gene | Description | Organism |
|---|
| Source | Proteus mirabilis HI4320 |
|---|---|
| Locus tag | PMI_RS19180 |
| Feature type | CDS |
| Gene | - |
| Product | conjugal transfer protein |
| Location | 8583 - 8717 (strand: 1) |
| Length | 135 (nucleotides) / 44 (amino acids) |
| Accession | NC_010555 |
|---|---|
| Length | 36289 nucleotides |
| Topology | circular |
| Plasmid | True |
| Orthogroup | group_4753 | |
|---|---|---|
| Orthogroup size | 1 | |
| N. genomes | 1 |
| ID | Function(s) descr. | Function(s) cat. | Description |
|---|---|---|---|
| COG5633 | Function unknown (S) | S | Uncharacterized conserved protein YcfL |
MKKFLFLIIVSIGLVGCASQKTVPPVSGGLEPVNTPEVMNTAGK
TCGGAAAAGAGGTCGCGGCGATTTATAAAAAACGGTTTGGGGGATGAATCATGAAAAAGTTTCTGTTTCTGATTATTGTCAGTATTGGATTAGTTGGTTGTGCCAGTCAAAAAACAGTTCCCCCCGTGTCGGGGGGATTAGAGCCTGTTAATACTCCGGAAGTAATGAATACCGCAGGGAAATGAAATGAAAAAAATTCAATTTTTTAAAAACAAAGAAACTGCCATAGAAAACG
