Homologs in group_3649

Help

4 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS19000 PMI_RS19000 57.4 Proteus mirabilis HI4320 - Hok/Gef family protein
PMI_RS19005 PMI_RS19005 57.4 Proteus mirabilis HI4320 - Hok/Gef family protein
PMI_RS19010 PMI_RS19010 57.4 Proteus mirabilis HI4320 - Hok/Gef family protein
PMI_RS19185 PMI_RS19185 48.9 Proteus mirabilis HI4320 - Hok/Gef family protein

Distribution of the homologs in the orthogroup group_3649

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3649

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P13970 9.6e-10 51 60 0 43 3 srnB Protein SrnB Escherichia coli (strain K12)
Q8X7U9 3.68e-05 39 46 0 43 3 hokG Putative protein HokG Escherichia coli O157:H7
Q7UDF9 7.51e-05 38 39 0 43 3 hokE Protein HokE Shigella flexneri
Q8XBW9 7.51e-05 38 39 0 43 3 hokE Protein HokE Escherichia coli O157:H7
P77091 8.57e-05 38 39 0 43 2 hokE Toxic protein HokE Escherichia coli (strain K12)
Q7UDG0 0.000271 37 37 0 43 3 hokF Putative protein HokF Shigella flexneri
Q8XBX0 0.000529 36 37 0 43 3 hokF Putative protein HokF Escherichia coli O157:H7

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18780
Feature type CDS
Gene -
Product Hok/Gef family protein
Location 37025 - 37168 (strand: 1)
Length 144 (nucleotides) / 47 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3649
Orthogroup size 5
N. genomes 1

Actions

Genomic region

Domains

PF01848 Hok/gef family

Protein Sequence

MTKITLFGITVVCVTVLMFALIVGERLCSLNISNGNMVVQAILMCHQ

Flanking regions ( +/- flanking 50bp)

AAAGCTCAACAACTTGATTCTGCCTCCTTTATTAAAAGGAGTCAATCAAATTGACGAAAATAACCTTATTTGGCATTACGGTTGTCTGTGTGACGGTACTTATGTTTGCTTTAATTGTCGGTGAACGATTATGTTCGCTTAACATTAGTAACGGAAACATGGTCGTTCAAGCTATTTTGATGTGTCATCAATAGCTTGATGGGGGAGGTTTCCTCCCCCCAATTTTTGTTCAAGTTGTGAGATA