Homologs in group_4827

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4827

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4827

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18715
Feature type CDS
Gene -
Product transcriptional regulator
Location 33397 - 33627 (strand: -1)
Length 231 (nucleotides) / 76 (amino acids)
In genomic island -

Contig

Accession NC_010555
Length 36289 nucleotides
Topology circular
Plasmid True

Orthology

Orthogroup group_4827
Orthogroup size 1
N. genomes 1

Actions

Genomic region

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2944 Transcription (K) K DNA-binding transcriptional regulator YiaG, XRE-type HTH domain

Protein Sequence

MENNAKNIKALRLKTGLTQKEMAERYGVGIRTWQKKEEDGTQSSQKLSNFDFEYLLLLAGEHPDFVLEKRNKEIAS

Flanking regions ( +/- flanking 50bp)

GGCAGATGATAAAGCCACAATTGAATTGCTTATAGGGGAGTTTTTTAAAAATGGAAAATAATGCAAAAAATATAAAAGCGTTGAGATTAAAAACAGGTTTAACACAAAAGGAAATGGCAGAAAGGTACGGGGTAGGGATCAGAACTTGGCAAAAAAAAGAGGAGGACGGGACGCAAAGCAGTCAGAAGTTATCAAATTTTGATTTTGAATACTTGCTGTTATTGGCTGGTGAGCATCCTGATTTTGTGCTGGAAAAAAGAAATAAGGAAATTGCAAGCTAATCGCTTGCGCTGCTCTTTGTTCGGGTGTGGCTGATTCTTTCTTTTGTCTG