Homologs in group_1206

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06555 FBDBKF_06555 71.6 Morganella morganii S1 gpmB 2,3-diphosphoglycerate-dependent phosphoglycerate mutase GpmB
EHELCC_09600 EHELCC_09600 71.6 Morganella morganii S2 gpmB 2,3-diphosphoglycerate-dependent phosphoglycerate mutase GpmB
NLDBIP_09980 NLDBIP_09980 71.6 Morganella morganii S4 gpmB 2,3-diphosphoglycerate-dependent phosphoglycerate mutase GpmB
LHKJJB_07775 LHKJJB_07775 71.6 Morganella morganii S3 gpmB 2,3-diphosphoglycerate-dependent phosphoglycerate mutase GpmB
HKOGLL_07325 HKOGLL_07325 71.6 Morganella morganii S5 gpmB 2,3-diphosphoglycerate-dependent phosphoglycerate mutase GpmB
F4V73_RS15380 F4V73_RS15380 71.6 Morganella psychrotolerans gpmB 2,3-diphosphoglycerate-dependent phosphoglycerate mutase GpmB

Distribution of the homologs in the orthogroup group_1206

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1206

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EY52 2.37e-157 436 100 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Proteus mirabilis (strain HI4320)
A7MIJ0 9.95e-121 344 76 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Cronobacter sakazakii (strain ATCC BAA-894)
A6TI09 1.32e-119 341 77 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y264 1.63e-119 341 77 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Klebsiella pneumoniae (strain 342)
A4W6B3 4.31e-118 337 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Enterobacter sp. (strain 638)
B7LNT7 1.61e-117 336 76 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8G9J4 2.14e-117 335 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Serratia proteamaculans (strain 568)
A9MR94 1.73e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8ZJU8 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TU55 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella schwarzengrund (strain CVM19633)
A9N7F5 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK44 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T4I9 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella newport (strain SL254)
B4TH18 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella heidelberg (strain SL476)
B5R9W3 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R3B7 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella enteritidis PT4 (strain P125109)
B5FTD9 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella dublin (strain CT_02021853)
B5F543 2.78e-116 333 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella agona (strain SL483)
Q8Z0T4 3.13e-116 332 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella typhi
B2VH13 7.21e-116 332 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C0Q8F5 1.53e-115 331 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi C (strain RKS4594)
Q57G26 2.25e-115 330 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella choleraesuis (strain SC-B67)
B5BAL1 5.01e-115 329 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Salmonella paratyphi A (strain AKU_12601)
A8ALW1 1.1e-114 328 75 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3YTZ9 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Shigella sonnei (strain Ss046)
P0A7A4 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Shigella flexneri
Q0SX17 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Shigella flexneri serotype 5b (strain 8401)
B1LEK2 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain SMS-3-5 / SECEC)
B6I6P3 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain SE11)
B7NH70 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7A2 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain K12)
B1IS24 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A8C4 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O9:H4 (strain HS)
B1XFK5 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain K12 / DH10B)
C4ZT77 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain K12 / MC4100 / BW2952)
B7LXV9 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O8 (strain IAI1)
B5Z4S7 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7A3 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O157:H7
B7LEP1 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain 55989 / EAEC)
A7ZVT7 2.54e-114 328 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q1R246 5.4e-114 327 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli (strain UTI89 / UPEC)
Q8FA40 5.4e-114 327 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T8R6 5.4e-114 327 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AJW4 5.4e-114 327 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O1:K1 / APEC
B7MTE3 5.4e-114 327 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O81 (strain ED1a)
B7NW76 5.4e-114 327 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MNK4 5.4e-114 327 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Escherichia coli O45:K1 (strain S88 / ExPEC)
Q31SU3 2.1e-113 325 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Shigella boydii serotype 4 (strain Sb227)
B2TZS8 2.1e-113 325 74 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q7N900 4.19e-113 325 72 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B1JL20 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66EU3 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQH5 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis (strain Pestoides F)
Q1CMX2 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis bv. Antiqua (strain Nepal516)
A9R032 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis bv. Antiqua (strain Angola)
Q8ZIP0 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis
B2K3K5 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C0L5 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMF8 1.27e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q327K0 2.37e-112 323 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Shigella dysenteriae serotype 1 (strain Sd197)
A1JJB8 3.18e-112 322 73 0 215 3 gpmB Probable phosphoglycerate mutase GpmB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
F4KI56 9.51e-25 100 34 6 211 1 IPSP Metal-independent phosphoserine phosphatase Arabidopsis thaliana
Q9SCS3 1.68e-24 99 36 9 219 2 At3g50520 Phosphoglycerate mutase-like protein 4 Arabidopsis thaliana
O07617 1.58e-22 93 31 4 206 3 phoE Uncharacterized phosphatase PhoE Bacillus subtilis (strain 168)
Q7ZVE3 6.38e-16 77 35 4 154 1 tigarb Fructose-2,6-bisphosphatase TIGAR B Danio rerio
W5EP13 1.01e-15 78 33 4 191 1 None 2-carboxy-D-arabinitol-1-phosphatase Triticum aestivum
Q9FNJ9 8.78e-15 75 32 4 187 1 At5g22620 Probable 2-carboxy-D-arabinitol-1-phosphatase Arabidopsis thaliana
P52086 4.14e-14 71 27 2 183 1 cobC Adenosylcobalamin/alpha-ribazole phosphatase Escherichia coli (strain K12)
Q1JQA7 4.76e-14 72 30 7 217 2 TIGAR Fructose-2,6-bisphosphatase TIGAR Bos taurus
D3DFG8 1.75e-13 69 28 0 164 1 pspA Phosphoserine phosphatase 1 Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
D3DFP8 3.12e-13 68 25 1 182 1 pspB Putative phosphoserine phosphatase 2 Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)
P39701 3.65e-13 68 26 2 186 1 cobC Adenosylcobalamin/alpha-ribazole phosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9NQ88 3.89e-13 69 36 4 128 1 TIGAR Fructose-2,6-bisphosphatase TIGAR Homo sapiens
Q12040 1.4e-12 67 26 8 219 1 YOR283W Broad-specificity phosphatase YOR283W Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B1WAX6 2.01e-12 67 34 3 130 2 tigar Fructose-2,6-bisphosphatase TIGAR Xenopus tropicalis
Q4V7R0 2.95e-12 67 35 3 122 2 tigar Fructose-2,6-bisphosphatase TIGAR Xenopus laevis
P58652 4.76e-12 65 26 2 186 3 cobC Adenosylcobalamin/alpha-ribazole phosphatase Salmonella typhi
Q29RA5 5.11e-12 66 30 3 135 2 tigara Probable fructose-2,6-bisphosphatase TIGAR A Danio rerio
Q8BZA9 1.12e-11 65 36 4 128 1 Tigar Fructose-2,6-bisphosphatase TIGAR Mus musculus
Q9HIJ2 4.89e-11 62 28 4 181 1 Ta1347 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
P07953 4.03e-10 62 32 6 164 1 Pfkfb1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Rattus norvegicus
P49872 5.98e-10 61 32 6 164 2 PFKFB1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Bos taurus
P16118 1.05e-09 60 31 6 164 1 PFKFB1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Homo sapiens
P9WIC7 1.44e-09 59 32 5 161 1 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WIC6 1.44e-09 59 32 5 161 3 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P70266 2.48e-09 59 31 6 164 1 Pfkfb1 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Mus musculus
P36623 2.77e-09 58 28 6 176 1 gpm1 Phosphoglycerate mutase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O60825 5.01e-09 58 32 7 167 1 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Homo sapiens
A4T096 1.22e-08 56 28 6 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
O35552 1.32e-08 57 31 6 164 2 Pfkfb3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Rattus norvegicus
P26285 1.33e-08 57 32 7 167 1 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Bos taurus
Q91309 1.33e-08 57 30 6 168 2 None 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Aquarana catesbeiana
A6LUA1 1.49e-08 56 26 6 198 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A2SDN6 2.01e-08 56 36 3 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q91348 2.36e-08 57 30 6 164 2 None 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Gallus gallus
B8EML2 3.16e-08 55 31 9 173 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q9JJH5 3.57e-08 56 32 7 167 1 Pfkfb2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Rattus norvegicus
Q5NVT1 3.72e-08 56 32 7 167 2 PFKFB2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Pongo abelii
Q7NJF7 4.21e-08 55 27 6 200 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
A1WDX2 4.35e-08 55 32 3 122 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Verminephrobacter eiseniae (strain EF01-2)
Q74L45 5.05e-08 55 29 10 193 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A1TC01 5.16e-08 55 34 4 130 1 gpgP Glucosyl-3-phosphoglycerate phosphatase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q7MXP1 7.56e-08 54 26 8 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B2RHB7 7.56e-08 54 26 8 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q16875 8.74e-08 55 31 6 164 1 PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Homo sapiens
Q63XU7 9.24e-08 54 27 6 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain K96243)
A3N5B0 9.24e-08 54 27 6 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 668)
Q3JWH7 9.24e-08 54 27 6 196 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 1710b)
A3NR09 9.24e-08 54 27 6 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia pseudomallei (strain 1106a)
A1UZX9 9.24e-08 54 27 6 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain SAVP1)
Q62F43 9.24e-08 54 27 6 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain ATCC 23344)
A2S625 9.24e-08 54 27 6 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain NCTC 10229)
A3MQ23 9.24e-08 54 27 6 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia mallei (strain NCTC 10247)
Q5R9C1 9.65e-08 55 31 6 164 2 PFKFB3 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 Pongo abelii
A5EV29 9.68e-08 54 26 7 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Dichelobacter nodosus (strain VCS1703A)
P70265 1.04e-07 55 31 7 167 1 Pfkfb2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 Mus musculus
Q6MEW4 1.22e-07 53 24 6 201 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Protochlamydia amoebophila (strain UWE25)
O94420 1.31e-07 54 30 5 168 3 SPCC1620.13 Probable phosphatase C1620.13 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8R7C8 1.45e-07 53 26 7 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q21122 1.5e-07 54 29 7 169 3 pfkb-1.2 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase Caenorhabditis elegans
Q0ALQ9 1.74e-07 53 33 5 122 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Maricaulis maris (strain MCS10)
B1XS92 2.37e-07 53 27 6 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q8A8R2 2.4e-07 53 24 7 197 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8RFG9 2.79e-07 52 24 6 195 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
A5E8K1 2.82e-07 52 28 8 170 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q0BBK5 2.83e-07 53 31 6 159 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A6WYJ2 2.96e-07 52 32 10 174 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B1JZ61 3.24e-07 52 31 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia orbicola (strain MC0-3)
B4EA64 3.24e-07 52 31 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B0KBW9 3.63e-07 52 26 8 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
P82612 3.85e-07 52 29 6 149 1 GPM1 Phosphoglycerate mutase Candida albicans (strain SC5314 / ATCC MYA-2876)
A1UTM4 4.21e-07 52 29 8 179 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B9L9H5 4.35e-07 52 34 2 93 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q2T1H5 4.37e-07 52 30 5 152 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P25114 4.57e-07 53 29 6 164 1 Pfkfb4 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 Rattus norvegicus
B0UBD4 4.6e-07 52 29 8 176 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylobacterium sp. (strain 4-46)
A4YJP8 4.64e-07 52 28 7 170 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium sp. (strain ORS 278)
Q4R8B6 4.7e-07 53 29 6 164 2 PFKFB4 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 Macaca fascicularis
Q6DTY7 4.79e-07 53 29 6 164 2 Pfkfb4 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 Mus musculus
Q16877 4.88e-07 53 29 6 164 1 PFKFB4 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 Homo sapiens
B9JYQ2 5.48e-07 52 33 6 134 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A7HZ35 5.54e-07 51 29 8 166 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q39CN6 6.52e-07 52 30 6 159 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B2SX15 6.9e-07 52 30 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A6UEW3 7.27e-07 51 30 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sinorhizobium medicae (strain WSM419)
B1YNA6 7.38e-07 51 30 6 159 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia ambifaria (strain MC40-6)
B4RZM6 1.06e-06 51 32 4 117 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B0K4E2 1.12e-06 51 26 7 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Thermoanaerobacter sp. (strain X514)
Q5YP50 1.15e-06 51 28 6 183 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nocardia farcinica (strain IFM 10152)
B9J6R3 1.17e-06 50 32 6 134 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B1M6A7 1.25e-06 50 28 6 174 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q21YW0 1.35e-06 50 29 5 144 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q30WZ8 1.5e-06 50 30 5 124 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B6JCI9 1.54e-06 50 29 8 165 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q38ZH8 1.85e-06 50 28 7 190 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Latilactobacillus sakei subsp. sakei (strain 23K)
Q6FZ12 2e-06 50 30 5 124 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella quintana (strain Toulouse)
C4K389 2.06e-06 50 26 6 191 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B8D7J7 2.31e-06 50 25 7 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D995 2.31e-06 50 25 7 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q6NJL2 2.46e-06 50 32 4 120 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B2IEV6 2.5e-06 50 27 8 177 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B1ZA86 3.07e-06 49 28 8 173 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
P57390 3.08e-06 49 25 7 216 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q88YY8 3.16e-06 49 27 8 192 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q8YDC9 3.18e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RMJ1 3.18e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella melitensis biotype 2 (strain ATCC 23457)
A9W5P5 3.2e-06 49 28 8 173 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum extorquens (strain PA1)
B7KNX9 3.2e-06 49 28 8 173 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q88T35 3.5e-06 49 29 4 116 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P59160 3.57e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella suis biovar 1 (strain 1330)
A9WW62 3.57e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9MCX8 3.57e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q576R3 3.57e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus biovar 1 (strain 9-941)
Q2YJN6 3.57e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus (strain 2308)
B2SC37 3.57e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella abortus (strain S19)
B0SY17 4e-06 49 33 5 130 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter sp. (strain K31)
A5VVV5 4.13e-06 49 31 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B8GYN6 4.15e-06 49 30 5 142 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A634 4.15e-06 49 30 5 142 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A4JI45 4.74e-06 49 30 6 159 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q98DM0 4.87e-06 48 32 6 134 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q8A765 5.36e-06 49 26 7 186 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B1Y3R5 7.58e-06 48 41 0 53 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q8L1Z7 8.6e-06 48 29 5 124 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B3QVL0 8.83e-06 48 28 5 152 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
P36136 9.83e-06 48 28 6 182 1 SHB17 Sedoheptulose 1,7-bisphosphatase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P30798 9.99e-06 48 27 7 188 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B2KBU4 1.01e-05 48 31 6 130 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Elusimicrobium minutum (strain Pei191)
B3EFK8 1.02e-05 48 26 8 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B1GZZ1 1.05e-05 48 28 6 153 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Endomicrobium trichonymphae
Q64R85 1.06e-05 48 25 7 187 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacteroides fragilis (strain YCH46)
Q5LAT7 1.06e-05 48 25 7 187 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
C4LLD4 1.07e-05 48 30 4 134 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q7W1Q6 1.07e-05 48 26 8 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q732Z5 1.12e-05 48 31 3 85 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q5P7N4 1.21e-05 48 29 6 150 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B5Y7Q7 1.27e-05 48 30 2 94 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
Q8KL44 1.28e-05 47 28 4 161 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
C5CWV9 1.34e-05 48 31 6 122 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Variovorax paradoxus (strain S110)
Q031Y3 1.41e-05 48 30 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. cremoris (strain SK11)
A2RI67 1.41e-05 48 30 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. cremoris (strain MG1363)
C5BJ25 1.66e-05 47 30 4 123 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q6HIL9 1.71e-05 47 24 7 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus thuringiensis subsp. konkukian (strain 97-27)
A4SDM0 1.71e-05 47 26 7 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A1K9B9 1.85e-05 47 24 6 201 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Azoarcus sp. (strain BH72)
Q4JSW4 1.94e-05 47 33 4 117 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium jeikeium (strain K411)
A8AW46 2.05e-05 47 27 5 147 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q2L0A6 2.06e-05 47 34 3 96 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella avium (strain 197N)
Q7VS43 2.12e-05 47 26 8 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WQN2 2.12e-05 47 26 8 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B0BPB3 2.13e-05 47 23 7 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H1G9 2.13e-05 47 23 7 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N0J2 2.13e-05 47 23 7 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C3MBY8 2.19e-05 47 31 5 134 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
C4XIQ5 2.23e-05 47 24 6 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q9CIM0 2.34e-05 47 30 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Lactococcus lactis subsp. lactis (strain IL1403)
B5XM69 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M49 (strain NZ131)
P0DD07 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48SP2 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RDV4 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J5W1 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JG44 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JL20 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JAX0 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M12 (strain MGAS2096)
P65711 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XB88 2.74e-05 47 31 4 116 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD06 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99Z29 2.74e-05 47 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pyogenes serotype M1
Q89WK1 2.8e-05 47 27 7 170 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A9BUZ3 2.96e-05 47 37 1 64 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Delftia acidovorans (strain DSM 14801 / SPH-1)
A7IC75 3.17e-05 46 27 7 173 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A4W369 3.62e-05 46 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus suis (strain 98HAH33)
Q0KET8 3.8e-05 47 27 4 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1QRT7 3.84e-05 46 31 6 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q92T25 3.93e-05 46 28 7 166 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium meliloti (strain 1021)
A9IXE7 3.96e-05 46 29 5 124 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bartonella tribocorum (strain CIP 105476 / IBS 506)
B8GFF8 4.12e-05 46 25 8 199 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
B2AGP7 4.14e-05 46 27 4 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A0AKV8 4.43e-05 46 25 7 200 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
B9J102 4.48e-05 46 25 8 199 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain Q1)
B7HS46 4.48e-05 46 25 8 199 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain AH187)
Q8Y2I3 4.81e-05 46 27 4 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2S101 4.85e-05 46 25 6 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia hermsii (strain HS1 / DAH)
Q38Z74 4.97e-05 46 28 4 130 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Latilactobacillus sakei subsp. sakei (strain 23K)
B8DFA5 5.41e-05 46 25 7 200 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4a (strain HCC23)
Q07UT3 5.42e-05 46 26 7 167 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodopseudomonas palustris (strain BisA53)
Q3SW71 5.47e-05 45 29 6 132 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q8Y571 5.51e-05 46 25 7 200 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8NTA5 5.75e-05 46 30 3 121 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QB41 5.75e-05 46 30 3 121 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Corynebacterium glutamicum (strain R)
B3PXK3 5.86e-05 45 29 8 165 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium etli (strain CIAT 652)
Q4FP74 6.02e-05 46 34 1 73 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pelagibacter ubique (strain HTCC1062)
B5ZWT2 6.15e-05 45 31 6 134 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
C1CSS1 6.15e-05 46 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLZ5 6.15e-05 46 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain P1031)
B2IRR1 6.15e-05 46 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain CGSP14)
B8ZM52 6.15e-05 46 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q839H4 6.32e-05 45 23 6 198 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Enterococcus faecalis (strain ATCC 700802 / V583)
Q54NE6 6.53e-05 46 32 1 70 1 gpmA Probable phosphoglycerate mutase Dictyostelium discoideum
Q737X5 6.59e-05 46 25 8 199 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Bacillus cereus (strain ATCC 10987 / NRS 248)
C1CFM7 6.64e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain JJA)
P0A3Y4 6.64e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A3Y3 6.64e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1I720 6.64e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain Hungary19A-6)
C1C8P5 6.64e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae (strain 70585)
B5E706 6.64e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 19F (strain G54)
Q04JB4 6.64e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q03KA9 7.09e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q8VVB5 7.09e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZF1 7.09e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus thermophilus (strain CNRZ 1066)
A3CLS0 7.36e-05 45 33 1 72 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus sanguinis (strain SK36)
B6IYD3 7.49e-05 45 26 8 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodospirillum centenum (strain ATCC 51521 / SW)
Q71XG0 7.75e-05 45 25 7 200 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4b (strain F2365)
C1KXG0 7.75e-05 45 25 7 200 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q11SV1 7.77e-05 45 26 4 162 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q8E0G9 7.87e-05 45 29 3 123 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E643 7.87e-05 45 29 3 123 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype III (strain NEM316)
Q3K1U2 7.87e-05 45 29 3 123 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C0MCW5 9.12e-05 45 29 3 123 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. zooepidemicus (strain H70)
B4U1Y5 9.12e-05 45 29 3 123 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M8R8 9.12e-05 45 29 3 123 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus equi subsp. equi (strain 4047)
A6L9K8 9.56e-05 45 23 8 242 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A9IFJ0 9.64e-05 45 33 3 96 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q01YD0 9.92e-05 45 24 7 198 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Solibacter usitatus (strain Ellin6076)
A1BE55 0.000103 45 25 6 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B2S2B5 0.00011 45 34 1 70 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema pallidum subsp. pallidum (strain SS14)
P96121 0.00011 45 34 1 70 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema pallidum (strain Nichols)
P64956 0.000112 45 31 4 183 4 BQ2027_MB2253C Uncharacterized protein Mb2253c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLH4 0.000112 45 31 4 183 4 MT2287 Uncharacterized protein MT2287 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P9WLH5 0.000112 45 31 4 183 1 Rv2228c Bifunctional protein Rv2228c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
Q2Y9Z7 0.000115 45 28 5 152 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B9DUS6 0.00012 45 34 1 67 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Streptococcus uberis (strain ATCC BAA-854 / 0140J)
A1R083 0.000127 45 24 6 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia turicatae (strain 91E135)
A1TTW5 0.000132 45 27 5 152 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paracidovorax citrulli (strain AAC00-1)
Q63B92 0.000147 45 25 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain ZK / E33L)
C1EUQ5 0.000147 45 25 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain 03BB102)
A0RE96 0.000147 45 25 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus thuringiensis (strain Al Hakam)
A8IGZ9 0.000155 44 29 8 168 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B7GUR7 0.000163 45 25 7 191 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
P59159 0.000163 45 25 7 191 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum (strain NCC 2705)
B3DQI6 0.000163 45 25 7 191 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bifidobacterium longum (strain DJO10A)
C1AZ61 0.000175 44 29 5 147 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodococcus opacus (strain B4)
Q3AU60 0.000175 44 27 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium chlorochromatii (strain CaD3)
Q82TU0 0.00018 44 24 7 193 3 gpmA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
P44865 0.000188 44 23 7 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q73M14 0.000189 44 26 8 195 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A5UDW8 0.000193 44 23 7 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain PittEE)
Q4QME2 0.000193 44 23 7 197 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain 86-028NP)
A1VKR6 0.000204 44 34 1 64 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Polaromonas naphthalenivorans (strain CJ2)
B7JPK2 0.000206 44 24 8 199 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain AH820)
Q6KSL4 0.000206 44 24 8 199 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis
C3LIE5 0.000206 44 24 8 199 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAW8 0.000206 44 24 8 199 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus anthracis (strain A0248)
P00950 0.000213 44 31 3 101 1 GPM1 Phosphoglycerate mutase 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
B2JC95 0.000224 44 28 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q476J7 0.000237 44 28 5 157 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A5UHR1 0.000238 44 23 7 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Haemophilus influenzae (strain PittGG)
B8F5J4 0.000243 44 23 7 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Glaesserella parasuis serovar 5 (strain SH0165)
Q0SF09 0.000247 44 29 5 147 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodococcus jostii (strain RHA1)
B4U616 0.000248 44 27 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Hydrogenobaculum sp. (strain Y04AAS1)
O94461 0.00025 44 24 8 213 3 SPAC1687.21 Probable phosphatase C1687.21 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q929G8 0.000272 44 25 8 201 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1MMY4 0.000281 43 30 7 134 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2N682 0.0003 43 30 5 123 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Erythrobacter litoralis (strain HTCC2594)
A1WBJ3 0.000325 43 38 0 47 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Acidovorax sp. (strain JS42)
Q21CH5 0.000337 43 26 7 167 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Rhodopseudomonas palustris (strain BisB18)
Q9PLK4 0.000342 43 26 7 192 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlamydia muridarum (strain MoPn / Nigg)
B9MEZ2 0.000354 43 38 0 47 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Acidovorax ebreus (strain TPSY)
Q6MJP3 0.000358 43 23 7 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q660L2 0.000386 43 32 2 94 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q2YBZ1 0.000401 43 36 2 94 3 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B3DZZ7 0.000412 43 29 5 117 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methylacidiphilum infernorum (isolate V4)
A6VLV0 0.000427 43 30 1 69 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
B3EN99 0.000447 43 25 5 152 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium phaeobacteroides (strain BS1)
Q9CKU9 0.000456 43 26 4 122 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pasteurella multocida (strain Pm70)
B7J2L3 0.00047 43 31 4 116 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella burgdorferi (strain ZS7)
O51602 0.00047 43 31 4 116 1 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q11CB5 0.000485 43 28 8 172 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chelativorans sp. (strain BNC1)
Q61CA3 0.000502 43 25 10 215 3 pgam-5 Serine/threonine-protein phosphatase Pgam5, mitochondrial Caenorhabditis briggsae
C0QV47 0.000511 43 31 1 70 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
B4S616 0.000538 43 27 6 154 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B0US27 0.000576 43 23 7 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Histophilus somni (strain 2336)
Q0I4D8 0.000576 43 23 7 196 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Histophilus somni (strain 129Pt)
Q81DD2 0.000581 43 24 8 198 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B4SEI0 0.000596 43 26 5 152 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q3B5J2 0.000614 43 32 1 64 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B5RMK4 0.000633 43 26 7 193 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Borrelia duttonii (strain Ly)
Q8TN93 0.000683 43 34 0 66 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q9LM13 0.000777 43 26 2 112 2 gpmA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 Arabidopsis thaliana
Q7N6S0 0.000845 42 37 1 62 3 gpmA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18490
Feature type CDS
Gene gpmB
Product 2,3-diphosphoglycerate-dependent phosphoglycerate mutase GpmB
Location 4059953 - 4060600 (strand: 1)
Length 648 (nucleotides) / 215 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1206
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00300 Histidine phosphatase superfamily (branch 1)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0406 Carbohydrate transport and metabolism (G) G Broad specificity phosphatase PhoE

Kegg Ortholog Annotation(s)

Protein Sequence

MLQVYLVRHGETEWNVARRIQGQSDSPLTAMGVRQAQQVAERVKSAGITHIISSDLGRTCQTAEIIAQACRCDVITDPRLRELDMGVLEQREIATLNTQEEAWRKSLIDGTPDGRIPQGESMVELANRMQAALNSCLALPEHSRPLLVSHGIALGCLLSTVLGLPAYAERRLRLRNCSISRVDYQNSPWLANGWVIETAGDVSHLTDIALDEVQR

Flanking regions ( +/- flanking 50bp)

ATGAGTTAATCATCCTTTGAAAAATTAGAGCAGTATAACGGAAAAAATGTATGTTACAGGTCTATCTTGTTCGCCACGGTGAAACTGAGTGGAACGTGGCGAGACGTATACAAGGGCAATCTGATAGCCCACTAACAGCAATGGGTGTGCGACAGGCACAACAAGTTGCTGAAAGAGTAAAATCAGCAGGTATTACCCACATAATTTCTAGTGATCTTGGCCGGACTTGTCAGACGGCAGAGATTATTGCACAAGCTTGTCGCTGTGACGTAATCACGGATCCCCGTTTGCGTGAACTTGATATGGGCGTTCTTGAACAGCGAGAGATCGCCACATTAAATACACAAGAAGAAGCTTGGCGCAAGAGTTTAATTGATGGTACACCTGATGGACGAATTCCCCAAGGAGAATCCATGGTGGAATTAGCTAATCGTATGCAGGCTGCTTTAAACAGTTGCTTGGCGTTACCAGAGCATAGCCGTCCTTTACTGGTGAGTCACGGTATTGCATTAGGTTGCCTGCTAAGTACTGTGTTAGGCCTACCAGCTTACGCTGAACGACGTTTAAGACTACGTAACTGTTCAATTTCACGAGTGGACTATCAAAACAGTCCTTGGCTCGCTAATGGATGGGTAATCGAAACAGCAGGGGATGTGAGTCATCTTACTGATATCGCTCTTGATGAAGTACAGCGTTAATGACAATAACAGACTCTCTTCGCTGTAAAAGAGAGTCTTATTGTTAGGCC