Homologs in group_710

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03080 FBDBKF_03080 68.9 Morganella morganii S1 dolP division/outer membrane stress-associated lipid-binding lipoprotein
EHELCC_07455 EHELCC_07455 68.9 Morganella morganii S2 dolP division/outer membrane stress-associated lipid-binding lipoprotein
NLDBIP_07780 NLDBIP_07780 68.9 Morganella morganii S4 dolP division/outer membrane stress-associated lipid-binding lipoprotein
LHKJJB_07315 LHKJJB_07315 68.9 Morganella morganii S3 dolP division/outer membrane stress-associated lipid-binding lipoprotein
HKOGLL_03615 HKOGLL_03615 68.9 Morganella morganii S5 dolP division/outer membrane stress-associated lipid-binding lipoprotein
F4V73_RS11840 F4V73_RS11840 70.5 Morganella psychrotolerans dolP division/outer membrane stress-associated lipid-binding lipoprotein

Distribution of the homologs in the orthogroup group_710

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_710

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7CPQ6 1.05e-76 231 67 1 191 2 dolP Outer membrane lipoprotein DolP Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P64596 1.75e-75 228 65 1 191 1 dolP Outer membrane lipoprotein DolP Escherichia coli (strain K12)
P64597 1.75e-75 228 65 1 191 3 dolP Outer membrane lipoprotein DolP Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P64598 1.75e-75 228 65 1 191 3 dolP Outer membrane lipoprotein DolP Escherichia coli O157:H7
P45301 3.2e-53 171 48 4 195 3 dolP Outer membrane lipoprotein DolP Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P46028 2.41e-41 141 49 1 155 3 hly 21 kDa hemolysin Actinobacillus pleuropneumoniae
P0AFH8 2.43e-07 52 30 5 195 1 osmY Osmotically-inducible protein Y Escherichia coli (strain K12)
P0AFH9 2.43e-07 52 30 5 195 3 osmY Osmotically-inducible protein Y Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18355
Feature type CDS
Gene dolP
Product division/outer membrane stress-associated lipid-binding lipoprotein
Location 4029009 - 4029587 (strand: -1)
Length 579 (nucleotides) / 192 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_710
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04972 BON domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2823 Cell wall/membrane/envelope biogenesis (M) M Osmotically-inducible protein OsmY, contains BON domain

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K04065 hyperosmotically inducible periplasmic protein - -

Protein Sequence

MKLLPITAVLCSALLLQGCIGAAVVGTAAVAGKTATDPRSLGQQVDDGTLEARVSGALNKNQQIKNSNARIVATAYQGNVLLTGQSPDMSVAETAKQVTSKVEGVNNVYNEVRQGEPVTLGTASSDTWLTTKVRSQILASDAVKSSSVKVITENGEVFLLGILTRQEGAAAAKIASETKGVVKVTTAFTYLN

Flanking regions ( +/- flanking 50bp)

ACTTAATTGATAATACATTATTCCCACATCAGGATGACTAAGGAGTTACTATGAAATTGCTTCCGATTACCGCAGTACTTTGTTCCGCGCTATTGCTACAAGGCTGTATTGGTGCCGCTGTGGTGGGTACTGCTGCCGTTGCTGGCAAAACCGCAACCGATCCTCGTTCATTAGGACAACAAGTTGATGATGGCACATTGGAAGCCCGAGTTTCTGGTGCTCTAAATAAAAACCAACAGATCAAGAACAGTAATGCGCGCATTGTCGCCACCGCTTATCAAGGTAATGTATTGTTAACTGGACAAAGTCCAGATATGTCGGTTGCTGAGACGGCCAAACAAGTTACCAGCAAAGTGGAAGGAGTAAACAATGTTTATAATGAAGTTCGCCAAGGTGAGCCTGTGACATTAGGCACTGCTTCTTCAGATACATGGTTAACCACTAAAGTACGTTCACAAATTTTAGCTAGCGATGCCGTCAAATCATCTTCCGTAAAAGTGATCACCGAAAATGGCGAAGTATTCTTGTTAGGGATATTGACCCGTCAAGAAGGGGCTGCAGCCGCTAAAATTGCCAGTGAAACCAAAGGTGTTGTTAAAGTAACAACGGCATTTACCTATCTAAACTAAATGTATCGCTGATGGGTATCACGTGGTGATAGCGTATTATTTTACCAGTA