Homologs in group_717

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03125 FBDBKF_03125 93.1 Morganella morganii S1 rpsI 30S ribosomal protein S9
EHELCC_07410 EHELCC_07410 93.1 Morganella morganii S2 rpsI 30S ribosomal protein S9
NLDBIP_07735 NLDBIP_07735 93.1 Morganella morganii S4 rpsI 30S ribosomal protein S9
LHKJJB_07270 LHKJJB_07270 93.1 Morganella morganii S3 rpsI 30S ribosomal protein S9
HKOGLL_03660 HKOGLL_03660 93.1 Morganella morganii S5 rpsI 30S ribosomal protein S9
F4V73_RS11795 F4V73_RS11795 93.8 Morganella psychrotolerans rpsI 30S ribosomal protein S9

Distribution of the homologs in the orthogroup group_717

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_717

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EXM0 2.71e-90 260 100 0 130 3 rpsI Small ribosomal subunit protein uS9 Proteus mirabilis (strain HI4320)
Q7N079 3.95e-88 254 97 0 130 3 rpsI Small ribosomal subunit protein uS9 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NWI3 1.17e-84 246 93 0 130 3 rpsI Small ribosomal subunit protein uS9 Sodalis glossinidius (strain morsitans)
C5B748 3.34e-84 244 93 0 130 3 rpsI Small ribosomal subunit protein uS9 Edwardsiella ictaluri (strain 93-146)
Q6DAE6 3.49e-84 244 92 0 130 3 rpsI Small ribosomal subunit protein uS9 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GK02 3.65e-84 244 92 0 130 3 rpsI Small ribosomal subunit protein uS9 Serratia proteamaculans (strain 568)
A4WF42 1.25e-83 243 92 0 130 3 rpsI Small ribosomal subunit protein uS9 Enterobacter sp. (strain 638)
C6DIQ2 3e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q32BA9 3.58e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Shigella dysenteriae serotype 1 (strain Sd197)
Q0T058 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Shigella flexneri serotype 5b (strain 8401)
Q31W98 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Shigella boydii serotype 4 (strain Sb227)
B2U1V5 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TEN8 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q1R6B0 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli (strain UTI89 / UPEC)
B1LGJ6 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli (strain SMS-3-5 / SECEC)
B6I1U8 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli (strain SE11)
B7NDK8 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7X3 4.08e-83 242 91 0 130 1 rpsI Small ribosomal subunit protein uS9 Escherichia coli (strain K12)
B1IQP9 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7X4 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCN6 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGC3 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O1:K1 / APEC
A8A539 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O9:H4 (strain HS)
B1XHK3 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli (strain K12 / DH10B)
C4ZSW8 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0U2 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O8 (strain IAI1)
B7N102 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O81 (strain ED1a)
B7NKU2 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YSV6 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7X5 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O157:H7
B7LHT8 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli (strain 55989 / EAEC)
B7MBZ1 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJW2 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSC4 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQC0 4.08e-83 242 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B2VGU9 7.72e-83 241 91 0 130 3 rpsI Small ribosomal subunit protein uS9 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q83Q07 8.15e-83 241 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Shigella flexneri
Q3YX18 1.28e-82 241 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Shigella sonnei (strain Ss046)
P66643 2.85e-82 240 90 0 130 1 rpsI Small ribosomal subunit protein uS9 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P66644 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella typhi
B4TWJ4 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella schwarzengrund (strain CVM19633)
B5BGP9 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella paratyphi A (strain AKU_12601)
A9N839 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJS6 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T754 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella newport (strain SL254)
B4TJR8 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella heidelberg (strain SL476)
B5R0L7 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella enteritidis PT4 (strain P125109)
B5FIS2 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella dublin (strain CT_02021853)
Q57JC4 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella choleraesuis (strain SC-B67)
A9MNY1 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7K4 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella agona (strain SL483)
B5XSS2 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Klebsiella pneumoniae (strain 342)
B7LRJ8 2.85e-82 240 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1JL67 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665L0 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THJ2 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pestis (strain Pestoides F)
Q1CE09 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1R9 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZB62 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pestis
B2K3Z6 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1G9 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDX5 3.39e-82 239 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JR92 1.12e-81 238 89 0 130 3 rpsI Small ribosomal subunit protein uS9 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
C0PZN9 1.54e-81 238 90 0 130 3 rpsI Small ribosomal subunit protein uS9 Salmonella paratyphi C (strain RKS4594)
C4K5S1 4.48e-80 234 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q7MNX0 4.16e-79 232 87 0 130 3 rpsI Small ribosomal subunit protein uS9 Vibrio vulnificus (strain YJ016)
Q8DEJ0 4.16e-79 232 87 0 130 3 rpsI Small ribosomal subunit protein uS9 Vibrio vulnificus (strain CMCP6)
B5FB54 6.89e-79 231 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Aliivibrio fischeri (strain MJ11)
Q5E2N0 6.89e-79 231 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Aliivibrio fischeri (strain ATCC 700601 / ES114)
C3LS61 8.21e-79 231 88 0 130 3 rpsI Small ribosomal subunit protein uS9 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUF0 8.21e-79 231 88 0 130 3 rpsI Small ribosomal subunit protein uS9 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F998 8.21e-79 231 88 0 130 3 rpsI Small ribosomal subunit protein uS9 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7VLF7 2.04e-78 230 89 0 129 3 rpsI Small ribosomal subunit protein uS9 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A7MWN0 2.49e-78 230 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Vibrio campbellii (strain ATCC BAA-1116)
A0KPZ2 4.75e-78 229 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q87SI4 5.48e-78 229 85 0 130 3 rpsI Small ribosomal subunit protein uS9 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CNB1 6.05e-78 229 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Pasteurella multocida (strain Pm70)
B6ELJ4 6.25e-78 229 85 0 130 3 rpsI Small ribosomal subunit protein uS9 Aliivibrio salmonicida (strain LFI1238)
B7VIY4 7.29e-78 229 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Vibrio atlanticus (strain LGP32)
A4SHZ5 1.23e-77 228 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Aeromonas salmonicida (strain A449)
B0BUG0 3.21e-77 227 87 0 129 3 rpsI Small ribosomal subunit protein uS9 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H130 3.21e-77 227 87 0 129 3 rpsI Small ribosomal subunit protein uS9 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A5UEV9 4.17e-77 227 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Haemophilus influenzae (strain PittGG)
A5UC54 4.17e-77 227 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Haemophilus influenzae (strain PittEE)
Q4QKG9 4.17e-77 227 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Haemophilus influenzae (strain 86-028NP)
B8F3F7 9.4e-77 226 86 0 129 3 rpsI Small ribosomal subunit protein uS9 Glaesserella parasuis serovar 5 (strain SH0165)
P44388 1.52e-76 225 86 0 130 3 rpsI Small ribosomal subunit protein uS9 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A3MZW7 2.05e-76 225 86 0 129 3 rpsI Small ribosomal subunit protein uS9 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65T21 5.15e-76 224 86 0 129 3 rpsI Small ribosomal subunit protein uS9 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P31782 6.7e-76 224 83 0 130 3 rpsI Small ribosomal subunit protein uS9 Histophilus somni
B0UTU5 6.7e-76 224 83 0 130 3 rpsI Small ribosomal subunit protein uS9 Histophilus somni (strain 2336)
Q0I2N2 6.7e-76 224 83 0 130 3 rpsI Small ribosomal subunit protein uS9 Histophilus somni (strain 129Pt)
A6VPF4 2.21e-75 222 85 0 129 3 rpsI Small ribosomal subunit protein uS9 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q15PI4 2.64e-75 222 82 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1SA66 7.48e-75 221 83 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A6VXZ2 4.38e-74 219 82 0 130 3 rpsI Small ribosomal subunit protein uS9 Marinomonas sp. (strain MWYL1)
C4LCK6 3.4e-73 217 83 0 130 3 rpsI Small ribosomal subunit protein uS9 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A1RNJ7 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella sp. (strain W3-18-1)
Q0HYX4 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella sp. (strain MR-7)
Q0HF31 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella sp. (strain MR-4)
A0KT12 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella sp. (strain ANA-3)
A4Y3E2 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EAG3 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L112 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella baltica (strain OS195)
A6WJ71 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella baltica (strain OS185)
A3D8R3 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E9M8 7.02e-73 216 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella baltica (strain OS223)
A3QI61 1.84e-72 215 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q1LU53 2.32e-72 215 80 1 131 3 rpsI Small ribosomal subunit protein uS9 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q47VT2 6.16e-72 214 80 0 130 3 rpsI Small ribosomal subunit protein uS9 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3K724 6.23e-71 211 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas fluorescens (strain Pf0-1)
B0KFU7 9.67e-71 211 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas putida (strain GB-1)
Q1I597 9.67e-71 211 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas entomophila (strain L48)
Q88N96 1.62e-70 210 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W8S0 1.62e-70 210 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q4K6H3 1.71e-70 210 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4XQQ4 4.16e-70 209 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas mendocina (strain ymp)
Q4ZNX3 9.36e-70 208 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas syringae pv. syringae (strain B728a)
Q87WW8 9.36e-70 208 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48EE1 9.36e-70 208 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1KII1 1.18e-69 208 77 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FR86 1.18e-69 208 77 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella sediminis (strain HAW-EB3)
C3K6E2 1.95e-69 207 75 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas fluorescens (strain SBW25)
A8H8M0 2.93e-69 207 77 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TUV6 3.13e-69 207 77 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella halifaxensis (strain HAW-EB4)
B1J1W9 8.3e-69 206 74 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas putida (strain W619)
B8CIP3 1.02e-68 206 77 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella piezotolerans (strain WP3 / JCM 13877)
C1DQ79 1.66e-68 205 74 0 130 3 rpsI Small ribosomal subunit protein uS9 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
P57470 2.43e-68 204 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9H3 2.43e-68 204 76 0 130 3 rpsI Small ribosomal subunit protein uS9 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B8D7S5 3.9e-68 204 75 0 130 3 rpsI Small ribosomal subunit protein uS9 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
Q2S9X3 1e-67 203 74 0 130 3 rpsI Small ribosomal subunit protein uS9 Hahella chejuensis (strain KCTC 2396)
A4VIF8 5.19e-67 201 73 0 130 3 rpsI Small ribosomal subunit protein uS9 Stutzerimonas stutzeri (strain A1501)
B3PBL9 5.02e-66 199 74 0 130 3 rpsI Small ribosomal subunit protein uS9 Cellvibrio japonicus (strain Ueda107)
A1U3H7 1.09e-65 198 75 0 130 3 rpsI Small ribosomal subunit protein uS9 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q0A6F4 3.99e-65 196 73 0 130 3 rpsI Small ribosomal subunit protein uS9 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q8K9G0 2.52e-64 194 72 0 130 3 rpsI Small ribosomal subunit protein uS9 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q5R0K5 5.13e-64 194 78 0 130 3 rpsI Small ribosomal subunit protein uS9 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q07XR9 5.66e-64 193 79 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella frigidimarina (strain NCIMB 400)
Q12RX7 5.66e-64 193 79 0 130 3 rpsI Small ribosomal subunit protein uS9 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P59514 8.49e-63 191 70 1 129 3 rpsI Small ribosomal subunit protein uS9 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q21FV9 5.6e-62 188 69 0 130 3 rpsI Small ribosomal subunit protein uS9 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C5BS65 1.75e-61 187 70 0 130 3 rpsI Small ribosomal subunit protein uS9 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q9HVY3 3.2e-60 184 73 0 130 1 rpsI Small ribosomal subunit protein uS9 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02H08 3.2e-60 184 73 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZL0 3.2e-60 184 73 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas aeruginosa (strain LESB58)
A6VBA5 5.41e-60 183 73 0 130 3 rpsI Small ribosomal subunit protein uS9 Pseudomonas aeruginosa (strain PA7)
Q493Y5 6.72e-59 181 67 1 132 3 rpsI Small ribosomal subunit protein uS9 Blochmanniella pennsylvanica (strain BPEN)
Q5P7T8 1.46e-57 177 67 0 130 3 rpsI Small ribosomal subunit protein uS9 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q60AF7 1.5e-57 177 68 0 130 3 rpsI Small ribosomal subunit protein uS9 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q82UK1 2.22e-57 177 67 0 130 3 rpsI Small ribosomal subunit protein uS9 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A6SUN8 3.71e-57 176 67 0 130 3 rpsI Small ribosomal subunit protein uS9 Janthinobacterium sp. (strain Marseille)
A1K970 7.74e-57 176 66 0 130 3 rpsI Small ribosomal subunit protein uS9 Azoarcus sp. (strain BH72)
A1ATL0 8.83e-57 175 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q0AHZ9 9.53e-57 175 66 0 130 3 rpsI Small ribosomal subunit protein uS9 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B9M6W3 1.24e-56 175 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A4G1T3 2.53e-56 174 66 0 130 3 rpsI Small ribosomal subunit protein uS9 Herminiimonas arsenicoxydans
Q3A3B7 7.08e-56 173 62 0 130 3 rpsI Small ribosomal subunit protein uS9 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A5GAY7 8.07e-56 173 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Geotalea uraniireducens (strain Rf4)
Q7WFC4 1.2e-55 172 65 0 130 3 rpsI Small ribosomal subunit protein uS9 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VQR6 1.76e-55 172 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Blochmanniella floridana
Q2KV03 1.88e-55 172 66 0 130 3 rpsI Small ribosomal subunit protein uS9 Bordetella avium (strain 197N)
Q475T2 2.19e-55 172 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q2YBK3 2.91e-55 171 65 0 130 3 rpsI Small ribosomal subunit protein uS9 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q13UB3 2.97e-55 171 65 0 130 3 rpsI Small ribosomal subunit protein uS9 Paraburkholderia xenovorans (strain LB400)
B2SYK9 2.97e-55 171 65 0 130 3 rpsI Small ribosomal subunit protein uS9 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A9I240 3.47e-55 171 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q83AX9 3.91e-55 171 67 1 135 3 rpsI Small ribosomal subunit protein uS9 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAB0 3.91e-55 171 67 1 135 3 rpsI Small ribosomal subunit protein uS9 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KBY1 3.91e-55 171 67 1 135 3 rpsI Small ribosomal subunit protein uS9 Coxiella burnetii (strain Dugway 5J108-111)
B6J2V0 3.91e-55 171 67 1 135 3 rpsI Small ribosomal subunit protein uS9 Coxiella burnetii (strain CbuG_Q212)
Q7VUV9 4.32e-55 171 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B2AH58 7.46e-55 171 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B2UFK2 8.24e-55 170 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Ralstonia pickettii (strain 12J)
A3DGC4 1.01e-54 170 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q7W3Z2 1.1e-54 170 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q63QW4 1.21e-54 170 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia pseudomallei (strain K96243)
Q0KED8 1.29e-54 170 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A2SKM0 1.54e-54 170 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q1LRC9 1.89e-54 169 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B2JGV1 1.98e-54 169 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B6J4Q5 3.07e-54 169 66 1 135 3 rpsI Small ribosomal subunit protein uS9 Coxiella burnetii (strain CbuK_Q154)
A1WYS8 3.74e-54 169 67 0 130 3 rpsI Small ribosomal subunit protein uS9 Halorhodospira halophila (strain DSM 244 / SL1)
Q3SF20 3.9e-54 169 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Thiobacillus denitrificans (strain ATCC 25259)
A4JBK5 4.65e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia vietnamiensis (strain G4 / LMG 22486)
A3NDG7 5.19e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia pseudomallei (strain 668)
Q3JNR2 5.19e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia pseudomallei (strain 1710b)
A3NZ79 5.19e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia pseudomallei (strain 1106a)
A1V052 5.19e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia mallei (strain SAVP1)
Q62HB9 5.19e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia mallei (strain ATCC 23344)
A2S582 5.19e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia mallei (strain NCTC 10229)
A3MP60 5.19e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia mallei (strain NCTC 10247)
A0PXY2 5.79e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium novyi (strain NT)
Q1BZ44 5.79e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia orbicola (strain AU 1054)
B1JVU5 5.79e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia orbicola (strain MC0-3)
Q39JJ9 5.79e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EET5 5.79e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K4K6 5.79e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia cenocepacia (strain HI2424)
Q0SQH9 5.92e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium perfringens (strain SM101 / Type A)
Q8XHV7 5.92e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium perfringens (strain 13 / Type A)
Q0TMT2 5.92e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B9MLF6 6.46e-54 168 61 0 130 3 rpsI Small ribosomal subunit protein uS9 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A5N4T2 6.82e-54 168 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYE4 6.82e-54 168 64 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium kluyveri (strain NBRC 12016)
Q2SZ68 6.9e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A9AH80 7.53e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia multivorans (strain ATCC 17616 / 249)
Q0BI90 7.87e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YTD2 7.87e-54 168 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Burkholderia ambifaria (strain MC40-6)
Q124N7 1.35e-53 167 66 0 123 3 rpsI Small ribosomal subunit protein uS9 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q8Y245 1.42e-53 167 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q97EL3 2.13e-53 167 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2TIL1 2.8e-53 166 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain Eklund 17B / Type B)
Q3A9V2 2.83e-53 166 62 0 130 3 rpsI Small ribosomal subunit protein uS9 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A4XJ60 1.02e-52 165 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B2UYE6 1.11e-52 165 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain Alaska E43 / Type E3)
Q8PD66 2.92e-52 164 69 0 130 3 rpsI Small ribosomal subunit protein uS9 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RN06 2.92e-52 164 69 0 130 3 rpsI Small ribosomal subunit protein uS9 Xanthomonas campestris pv. campestris (strain B100)
Q4UZF1 2.92e-52 164 69 0 130 3 rpsI Small ribosomal subunit protein uS9 Xanthomonas campestris pv. campestris (strain 8004)
Q8R7Y9 3.8e-52 164 62 0 130 3 rpsI Small ribosomal subunit protein uS9 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A1VJJ4 3.88e-52 164 64 0 123 3 rpsI Small ribosomal subunit protein uS9 Polaromonas naphthalenivorans (strain CJ2)
Q3BYA8 4.24e-52 164 69 0 130 3 rpsI Small ribosomal subunit protein uS9 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PQ41 4.24e-52 164 69 0 130 3 rpsI Small ribosomal subunit protein uS9 Xanthomonas axonopodis pv. citri (strain 306)
Q890R7 5.16e-52 163 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium tetani (strain Massachusetts / E88)
B1Y3K6 5.4e-52 163 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A9KJF4 1.06e-51 162 59 0 130 3 rpsI Small ribosomal subunit protein uS9 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q220T1 1.37e-51 162 64 0 123 3 rpsI Small ribosomal subunit protein uS9 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B4RQK5 1.38e-51 162 62 0 130 3 rpsI Small ribosomal subunit protein uS9 Neisseria gonorrhoeae (strain NCCP11945)
Q5F5A4 1.38e-51 162 62 0 130 3 rpsI Small ribosomal subunit protein uS9 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1TUF5 1.69e-51 162 64 0 123 3 rpsI Small ribosomal subunit protein uS9 Paracidovorax citrulli (strain AAC00-1)
A0L481 3.79e-51 161 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B8I816 3.92e-51 161 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B8GNH0 4.67e-51 161 67 0 130 3 rpsI Small ribosomal subunit protein uS9 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q8D362 4.94e-51 160 63 0 128 3 rpsI Small ribosomal subunit protein uS9 Wigglesworthia glossinidia brevipalpis
A1W3P8 5.81e-51 160 64 0 123 3 rpsI Small ribosomal subunit protein uS9 Acidovorax sp. (strain JS42)
B9MD53 5.81e-51 160 64 0 123 3 rpsI Small ribosomal subunit protein uS9 Acidovorax ebreus (strain TPSY)
Q5GV67 6.27e-51 160 68 0 130 3 rpsI Small ribosomal subunit protein uS9 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SL10 6.27e-51 160 68 0 130 3 rpsI Small ribosomal subunit protein uS9 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NYE4 6.27e-51 160 68 0 130 3 rpsI Small ribosomal subunit protein uS9 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2FJU3 6.34e-51 160 70 0 130 3 rpsI Small ribosomal subunit protein uS9 Stenotrophomonas maltophilia (strain K279a)
B4SLE0 6.34e-51 160 70 0 130 3 rpsI Small ribosomal subunit protein uS9 Stenotrophomonas maltophilia (strain R551-3)
A1KWD5 1.1e-50 160 61 0 130 3 rpsI Small ribosomal subunit protein uS9 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66642 1.1e-50 160 61 0 130 3 rpsI Small ribosomal subunit protein uS9 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66641 1.1e-50 160 61 0 130 3 rpsI Small ribosomal subunit protein uS9 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M088 1.1e-50 160 61 0 130 3 rpsI Small ribosomal subunit protein uS9 Neisseria meningitidis serogroup C (strain 053442)
A9C178 1.83e-50 159 61 0 130 3 rpsI Small ribosomal subunit protein uS9 Delftia acidovorans (strain DSM 14801 / SPH-1)
A1WL75 2.66e-50 159 65 0 123 3 rpsI Small ribosomal subunit protein uS9 Verminephrobacter eiseniae (strain EF01-2)
B1I1E6 4.26e-50 158 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Desulforudis audaxviator (strain MP104C)
Q7NRT4 5.98e-50 158 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9KGD4 6.32e-50 158 61 0 130 3 rpsI Small ribosomal subunit protein uS9 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
C4ZI84 7.05e-50 158 59 0 130 3 rpsI Small ribosomal subunit protein uS9 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
C5CM23 2.74e-49 156 61 0 123 3 rpsI Small ribosomal subunit protein uS9 Variovorax paradoxus (strain S110)
A6LPU7 3.13e-49 156 59 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q5WLM8 3.41e-49 156 59 0 130 3 rpsI Small ribosomal subunit protein uS9 Shouchella clausii (strain KSM-K16)
A6TWE6 4.74e-49 155 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Alkaliphilus metalliredigens (strain QYMF)
B4UBJ2 9.76e-49 155 59 0 130 3 rpsI Small ribosomal subunit protein uS9 Anaeromyxobacter sp. (strain K)
Q2IEX8 9.76e-49 155 59 0 130 3 rpsI Small ribosomal subunit protein uS9 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J5I5 9.76e-49 155 59 0 130 3 rpsI Small ribosomal subunit protein uS9 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B1KSI9 1.11e-48 155 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJ38 1.11e-48 155 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IGB8 1.11e-48 155 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain Okra / Type B1)
C1FMR5 1.11e-48 155 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain Kyoto / Type A2)
A5I7H0 1.11e-48 155 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KVL5 1.11e-48 155 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain 657 / Type Ba4)
A7FZ37 1.11e-48 155 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridium botulinum (strain ATCC 19397 / Type A)
B1YH85 1.14e-48 155 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
A9W606 2.61e-48 155 56 0 129 3 rpsI Small ribosomal subunit protein uS9 Methylorubrum extorquens (strain PA1)
B7KPU6 2.61e-48 155 56 0 129 3 rpsI Small ribosomal subunit protein uS9 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B0U6Z5 3.12e-48 154 67 0 130 3 rpsI Small ribosomal subunit protein uS9 Xylella fastidiosa (strain M12)
B0K5S8 3.48e-48 154 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Thermoanaerobacter sp. (strain X514)
B0KCN5 3.48e-48 154 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q9PD43 4.14e-48 153 66 0 130 3 rpsI Small ribosomal subunit protein uS9 Xylella fastidiosa (strain 9a5c)
B1ZCB4 4.36e-48 154 56 0 129 3 rpsI Small ribosomal subunit protein uS9 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A8MLH6 7.24e-48 153 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Alkaliphilus oremlandii (strain OhILAs)
A5D5F7 9.51e-48 152 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B2A4Q7 9.8e-48 152 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q87DD4 1.44e-47 152 66 0 130 3 rpsI Small ribosomal subunit protein uS9 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2IAE7 1.44e-47 152 66 0 130 3 rpsI Small ribosomal subunit protein uS9 Xylella fastidiosa (strain M23)
B1M201 2.13e-47 152 55 0 129 3 rpsI Small ribosomal subunit protein uS9 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B0S3F6 2.58e-47 151 55 0 130 3 rpsI Small ribosomal subunit protein uS9 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
Q8ETV3 3.04e-47 151 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B0TC92 4.65e-47 150 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B2IK87 6.24e-47 151 57 0 124 3 rpsI Small ribosomal subunit protein uS9 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
C5D3V1 9.9e-47 150 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Geobacillus sp. (strain WCH70)
Q18CJ5 1.05e-46 150 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Clostridioides difficile (strain 630)
Q0AUL6 1.37e-46 149 55 0 130 3 rpsI Small ribosomal subunit protein uS9 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
C4KZL2 1.77e-46 149 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B8H554 2.92e-46 150 57 0 129 3 rpsI Small ribosomal subunit protein uS9 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8H6 2.92e-46 150 57 0 129 3 rpsI Small ribosomal subunit protein uS9 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B8ENN1 4.81e-46 149 55 0 129 3 rpsI Small ribosomal subunit protein uS9 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B0UQW5 1.24e-45 148 54 0 129 3 rpsI Small ribosomal subunit protein uS9 Methylobacterium sp. (strain 4-46)
Q0SNH4 1.24e-45 147 59 0 127 3 rpsI Small ribosomal subunit protein uS9 Borreliella afzelii (strain PKo)
Q1AU64 1.54e-45 147 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
B1HMU8 1.96e-45 147 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Lysinibacillus sphaericus (strain C3-41)
B8IUF0 2.3e-45 147 53 0 129 3 rpsI Small ribosomal subunit protein uS9 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A1VBD2 2.53e-45 146 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Nitratidesulfovibrio vulgaris (strain DP4)
Q728T3 2.53e-45 146 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q03PZ0 3.32e-45 146 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q661S9 3.91e-45 146 59 0 127 3 rpsI Small ribosomal subunit protein uS9 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B0T0S3 4.74e-45 147 55 0 129 3 rpsI Small ribosomal subunit protein uS9 Caulobacter sp. (strain K31)
B8IZP3 5.37e-45 145 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q89KE5 5.44e-45 146 54 0 127 3 rpsI Small ribosomal subunit protein uS9 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B7J1R3 6.75e-45 145 59 0 127 3 rpsI Small ribosomal subunit protein uS9 Borreliella burgdorferi (strain ZS7)
O51313 6.75e-45 145 59 0 127 1 rpsI Small ribosomal subunit protein uS9 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q07MN9 8.92e-45 146 55 0 127 3 rpsI Small ribosomal subunit protein uS9 Rhodopseudomonas palustris (strain BisA53)
Q6HPM5 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H57 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain ZK / E33L)
Q81J12 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZM8 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain Q1)
B7HQX8 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain AH187)
B7HJJ1 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain B4264)
C1ET73 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain 03BB102)
B7IT53 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain G9842)
Q73F62 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKF4 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cereus (strain AH820)
A0R8L3 9.6e-45 145 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus thuringiensis (strain Al Hakam)
A7GK54 1.64e-44 144 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A9EYT5 1.71e-44 144 55 0 130 3 rpsI Small ribosomal subunit protein uS9 Sorangium cellulosum (strain So ce56)
B6JGT6 1.78e-44 145 57 0 124 3 rpsI Small ribosomal subunit protein uS9 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A7INH2 1.79e-44 145 54 0 124 3 rpsI Small ribosomal subunit protein uS9 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q2IWN6 1.9e-44 145 55 0 124 3 rpsI Small ribosomal subunit protein uS9 Rhodopseudomonas palustris (strain HaA2)
B3QKG4 1.93e-44 145 56 0 124 3 rpsI Small ribosomal subunit protein uS9 Rhodopseudomonas palustris (strain TIE-1)
Q6N650 1.93e-44 145 56 0 124 1 rpsI Small ribosomal subunit protein uS9 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A4YVP2 2.06e-44 145 55 0 124 3 rpsI Small ribosomal subunit protein uS9 Bradyrhizobium sp. (strain ORS 278)
Q8E1Y6 2.18e-44 144 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7E4 2.18e-44 144 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus agalactiae serotype III (strain NEM316)
Q3K3F8 2.18e-44 144 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
B7GJ32 2.99e-44 144 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A4WUK1 3.55e-44 144 53 0 124 3 rpsI Small ribosomal subunit protein uS9 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A7Z0S2 3.61e-44 143 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P21470 3.98e-44 143 56 0 130 1 rpsI Small ribosomal subunit protein uS9 Bacillus subtilis (strain 168)
A9VPB1 4.44e-44 143 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus mycoides (strain KBAB4)
Q1QKK3 4.74e-44 144 55 0 124 3 rpsI Small ribosomal subunit protein uS9 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q136Q2 4.9e-44 144 55 0 124 3 rpsI Small ribosomal subunit protein uS9 Rhodopseudomonas palustris (strain BisB5)
Q65P72 5.35e-44 143 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q02VM1 6.8e-44 143 54 0 130 3 rpsI Small ribosomal subunit protein uS9 Lactococcus lactis subsp. cremoris (strain SK11)
A2RP61 6.8e-44 143 54 0 130 1 rpsI Small ribosomal subunit protein uS9 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CDG7 6.8e-44 143 54 0 130 3 rpsI Small ribosomal subunit protein uS9 Lactococcus lactis subsp. lactis (strain IL1403)
B9KT42 7.72e-44 144 53 0 124 3 rpsI Small ribosomal subunit protein uS9 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J1Z5 7.72e-44 144 53 0 124 3 rpsI Small ribosomal subunit protein uS9 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PK94 7.72e-44 144 53 0 124 3 rpsI Small ribosomal subunit protein uS9 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A0ALT2 9.65e-44 142 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q03MU5 9.76e-44 142 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M6E6 9.76e-44 142 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M1V6 9.76e-44 142 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus thermophilus (strain CNRZ 1066)
A5EKC6 1.01e-43 143 55 0 124 3 rpsI Small ribosomal subunit protein uS9 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8DW97 1.4e-43 142 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q3SSQ8 1.51e-43 143 54 0 124 3 rpsI Small ribosomal subunit protein uS9 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
C0ZIL4 1.51e-43 142 60 0 130 3 rpsI Small ribosomal subunit protein uS9 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q8Y459 1.56e-43 142 56 0 130 1 rpsI Small ribosomal subunit protein uS9 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
A8F9B9 1.56e-43 142 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus pumilus (strain SAFR-032)
B6IMQ2 1.95e-43 142 56 0 124 3 rpsI Small ribosomal subunit protein uS9 Rhodospirillum centenum (strain ATCC 51521 / SW)
B8DB44 2.14e-43 141 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WI2 2.14e-43 141 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Listeria monocytogenes serotype 4b (strain F2365)
C1KZ11 2.14e-43 141 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q927P3 2.14e-43 141 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A9IVX6 2.5e-43 142 56 0 124 3 rpsI Small ribosomal subunit protein uS9 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q57DW2 2.55e-43 142 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella abortus biovar 1 (strain 9-941)
Q2YND9 2.55e-43 142 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella abortus (strain 2308)
B2S535 2.55e-43 142 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella abortus (strain S19)
Q81VP8 2.58e-43 141 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus anthracis
C3LJX8 2.58e-43 141 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAK4 2.58e-43 141 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Bacillus anthracis (strain A0248)
B4U561 2.64e-43 141 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
C0M903 2.64e-43 141 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus equi subsp. equi (strain 4047)
A8I7Z9 2.75e-43 142 54 0 124 3 rpsI Small ribosomal subunit protein uS9 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A7HXB2 2.81e-43 142 58 0 124 3 rpsI Small ribosomal subunit protein uS9 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A1UT84 4.05e-43 142 55 0 124 3 rpsI Small ribosomal subunit protein uS9 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
C0MFN0 4.13e-43 140 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus equi subsp. zooepidemicus (strain H70)
C1CC86 4.27e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae (strain JJA)
Q8CWU4 4.27e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2ISM4 4.27e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae (strain CGSP14)
B1I922 4.27e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae (strain Hungary19A-6)
C1CB69 4.27e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae (strain 70585)
B5E6W9 4.27e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae serotype 19F (strain G54)
Q04MF5 4.27e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q6G3I7 4.61e-43 142 55 0 124 3 rpsI Small ribosomal subunit protein uS9 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q0BZT3 5.57e-43 141 57 0 129 3 rpsI Small ribosomal subunit protein uS9 Hyphomonas neptunium (strain ATCC 15444)
C1CPG8 5.68e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CIH6 5.68e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae (strain P1031)
Q97SN4 5.68e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZL30 5.68e-43 140 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q31IG5 6.2e-43 140 63 0 130 3 rpsI Small ribosomal subunit protein uS9 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2RSE4 6.31e-43 141 55 0 129 3 rpsI Small ribosomal subunit protein uS9 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8G1C9 1.05e-42 140 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella suis biovar 1 (strain 1330)
B0CLB7 1.05e-42 140 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VPX4 1.05e-42 140 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
A9MAG7 1.05e-42 140 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8YGJ0 1.13e-42 140 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A6X1V5 1.13e-42 140 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
C0RIC5 1.14e-42 140 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Brucella melitensis biotype 2 (strain ATCC 23457)
Q982W9 1.42e-42 140 54 0 124 3 rpsI Small ribosomal subunit protein uS9 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q1MQW3 1.55e-42 139 54 0 130 3 rpsI Small ribosomal subunit protein uS9 Lawsonia intracellularis (strain PHE/MN1-00)
B9JVC4 1.66e-42 140 52 0 129 3 rpsI Small ribosomal subunit protein uS9 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q82Z47 2.06e-42 139 53 0 130 1 rpsI Small ribosomal subunit protein uS9 Enterococcus faecalis (strain ATCC 700802 / V583)
B8DPL8 2.3e-42 139 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q8RGG8 3.58e-42 139 56 1 128 3 rpsI Small ribosomal subunit protein uS9 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q9X1G4 4.12e-42 138 54 1 128 3 rpsI Small ribosomal subunit protein uS9 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B1LBJ1 4.21e-42 138 54 1 128 3 rpsI Small ribosomal subunit protein uS9 Thermotoga sp. (strain RQ2)
Q6YR77 5.9e-42 138 55 0 130 3 rpsI Small ribosomal subunit protein uS9 Onion yellows phytoplasma (strain OY-M)
Q30Y42 5.9e-42 138 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A5IMD2 8.11e-42 137 54 1 128 3 rpsI Small ribosomal subunit protein uS9 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
B9K8D3 8.11e-42 137 54 1 128 3 rpsI Small ribosomal subunit protein uS9 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q2NIP5 1.1e-41 137 55 0 130 3 rpsI Small ribosomal subunit protein uS9 Aster yellows witches'-broom phytoplasma (strain AYWB)
B5ZXZ5 1.14e-41 138 53 0 124 3 rpsI Small ribosomal subunit protein uS9 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
P62669 1.39e-41 137 53 0 126 1 rpsI Small ribosomal subunit protein uS9 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
A0LIV3 1.53e-41 137 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
P31177 1.59e-41 137 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus carnosus (strain TM300)
B3PVW3 1.61e-41 137 53 0 124 3 rpsI Small ribosomal subunit protein uS9 Rhizobium etli (strain CIAT 652)
Q03EE9 2.19e-41 136 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
P80374 2.2e-41 136 53 0 126 1 rpsI Small ribosomal subunit protein uS9 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q4L880 4.31e-41 135 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus haemolyticus (strain JCSC1435)
Q8CRJ0 4.41e-41 135 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM32 4.41e-41 135 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6FZQ5 4.77e-41 137 53 0 124 3 rpsI Small ribosomal subunit protein uS9 Bartonella quintana (strain Toulouse)
Q8UFZ8 4.97e-41 136 53 0 124 3 rpsI Small ribosomal subunit protein uS9 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1RK10 5.22e-41 137 51 0 125 3 rpsI Small ribosomal subunit protein uS9 Rickettsia bellii (strain RML369-C)
A8GXN6 5.22e-41 137 51 0 125 3 rpsI Small ribosomal subunit protein uS9 Rickettsia bellii (strain OSU 85-389)
Q1MIP3 5.54e-41 136 52 0 124 3 rpsI Small ribosomal subunit protein uS9 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A9BHB5 9.46e-41 135 55 1 130 3 rpsI Small ribosomal subunit protein uS9 Petrotoga mobilis (strain DSM 10674 / SJ95)
A4J153 1.03e-40 135 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q2K9W4 1.8e-40 135 52 0 124 3 rpsI Small ribosomal subunit protein uS9 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q88XU7 2.54e-40 134 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
P66647 3.26e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain MW2)
Q6G7A4 3.26e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain MSSA476)
Q6GEL8 3.26e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain MRSA252)
P66646 3.26e-40 133 51 0 130 1 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain N315)
P66645 3.26e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ59 3.26e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain Newman)
A5IV01 3.26e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain JH9)
A6U3U2 3.26e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain JH1)
A7X5B3 3.26e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B9E9M4 4.19e-40 133 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Macrococcus caseolyticus (strain JCSC5402)
Q49ZD5 5.39e-40 133 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
C4XNQ1 7.56e-40 132 53 0 130 3 rpsI Small ribosomal subunit protein uS9 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A6U7T6 8.39e-40 133 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Sinorhizobium medicae (strain WSM419)
A8Z324 1.26e-39 132 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain USA300 / TCH1516)
Q5HDZ1 1.26e-39 132 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain COL)
Q2YYM9 1.26e-39 132 50 0 130 1 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FW39 1.26e-39 132 50 0 130 1 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FES2 1.26e-39 132 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Staphylococcus aureus (strain USA300)
C6C1K0 3.57e-39 131 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q47LM6 4.29e-39 132 53 1 124 3 rpsI Small ribosomal subunit protein uS9 Thermobifida fusca (strain YX)
C3MA32 4.6e-39 131 50 0 129 3 rpsI Small ribosomal subunit protein uS9 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B1VA58 5.47e-39 130 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Phytoplasma australiense
B5ZC90 6.25e-39 130 56 0 126 3 rpsI Small ribosomal subunit protein uS9 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q9PPR3 6.75e-39 130 55 0 126 3 rpsI Small ribosomal subunit protein uS9 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJL7 6.75e-39 130 55 0 126 3 rpsI Small ribosomal subunit protein uS9 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
C5CDI2 7.34e-39 130 51 1 129 3 rpsI Small ribosomal subunit protein uS9 Kosmotoga olearia (strain ATCC BAA-1733 / DSM 21960 / TBF 19.5.1)
Q2RFT3 1.3e-38 129 56 0 130 3 rpsI Small ribosomal subunit protein uS9 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q92QR5 1.74e-38 130 51 0 129 3 rpsI Small ribosomal subunit protein uS9 Rhizobium meliloti (strain 1021)
Q5L3Q5 2.36e-38 129 58 0 130 3 rpsI Small ribosomal subunit protein uS9 Geobacillus kaustophilus (strain HTA426)
Q1WSC3 3.07e-38 128 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Ligilactobacillus salivarius (strain UCC118)
A8EXY2 3.87e-38 129 49 0 127 3 rpsI Small ribosomal subunit protein uS9 Rickettsia canadensis (strain McKiel)
A8GRA1 4.84e-38 129 50 1 130 3 rpsI Small ribosomal subunit protein uS9 Rickettsia rickettsii (strain Sheila Smith)
B0BWQ1 4.84e-38 129 50 1 130 3 rpsI Small ribosomal subunit protein uS9 Rickettsia rickettsii (strain Iowa)
A6Q6P0 4.88e-38 128 48 1 125 3 rpsI Small ribosomal subunit protein uS9 Sulfurovum sp. (strain NBC37-1)
B3EU85 8.18e-38 127 52 0 123 3 rpsI Small ribosomal subunit protein uS9 Amoebophilus asiaticus (strain 5a2)
A4IJM1 1.02e-37 127 57 0 130 3 rpsI Small ribosomal subunit protein uS9 Geobacillus thermodenitrificans (strain NG80-2)
Q68XD4 1.34e-37 128 50 0 127 3 rpsI Small ribosomal subunit protein uS9 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UKS7 1.38e-37 128 50 1 130 3 rpsI Small ribosomal subunit protein uS9 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q7UEY4 1.48e-37 127 51 0 128 3 rpsI Small ribosomal subunit protein uS9 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
C1A3Z4 1.49e-37 127 50 0 127 3 rpsI Small ribosomal subunit protein uS9 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
Q9ZDU0 1.53e-37 127 50 0 127 3 rpsI Small ribosomal subunit protein uS9 Rickettsia prowazekii (strain Madrid E)
Q035C4 1.73e-37 126 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WAH9 1.73e-37 126 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Lacticaseibacillus casei (strain BL23)
C4K0V7 2.13e-37 127 50 1 130 3 rpsI Small ribosomal subunit protein uS9 Rickettsia peacockii (strain Rustic)
B5RLS3 2.46e-37 126 57 0 123 3 rpsI Small ribosomal subunit protein uS9 Borrelia duttonii (strain Ly)
P07842 2.5e-37 126 56 0 130 1 rpsI Small ribosomal subunit protein uS9 Geobacillus stearothermophilus
A8GMN0 2.58e-37 127 48 0 129 3 rpsI Small ribosomal subunit protein uS9 Rickettsia akari (strain Hartford)
Q6KI60 3.05e-37 126 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711)
A4W3W8 3.75e-37 125 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus suis (strain 98HAH33)
A1QZD0 4.15e-37 125 57 0 123 3 rpsI Small ribosomal subunit protein uS9 Borrelia turicatae (strain 91E135)
Q38UV5 4.57e-37 125 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Latilactobacillus sakei subsp. sakei (strain 23K)
Q9RXY0 7.4e-37 125 52 2 128 3 rpsI Small ribosomal subunit protein uS9 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A8F0Z2 8.06e-37 125 50 1 130 3 rpsI Small ribosomal subunit protein uS9 Rickettsia massiliae (strain Mtu5)
Q92IV4 1.05e-36 125 49 1 130 3 rpsI Small ribosomal subunit protein uS9 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
B1XJI0 1.19e-36 124 50 1 126 3 rpsI Small ribosomal subunit protein uS9 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
C3PMT0 1.19e-36 125 49 1 130 3 rpsI Small ribosomal subunit protein uS9 Rickettsia africae (strain ESF-5)
A8AV68 1.38e-36 124 52 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B9DTF3 2.8e-36 123 51 0 130 3 rpsI Small ribosomal subunit protein uS9 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C1D165 3.76e-36 123 50 2 128 3 rpsI Small ribosomal subunit protein uS9 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B3EFY3 3.85e-36 123 52 0 121 3 rpsI Small ribosomal subunit protein uS9 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B5RRF2 3.89e-36 123 56 0 123 3 rpsI Small ribosomal subunit protein uS9 Borrelia recurrentis (strain A1)
Q24ZM5 4.41e-36 123 55 0 129 3 rpsI Small ribosomal subunit protein uS9 Desulfitobacterium hafniense (strain Y51)
B8FW05 4.41e-36 123 55 0 129 3 rpsI Small ribosomal subunit protein uS9 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q11QN5 4.6e-36 123 52 0 121 3 rpsI Small ribosomal subunit protein uS9 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A8ZWE7 6.21e-36 122 47 0 130 3 rpsI Small ribosomal subunit protein uS9 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A6Q5F6 6.73e-36 122 49 1 128 3 rpsI Small ribosomal subunit protein uS9 Nitratiruptor sp. (strain SB155-2)
B2S045 7.58e-36 122 57 0 123 3 rpsI Small ribosomal subunit protein uS9 Borrelia hermsii (strain HS1 / DAH)
B0RB77 7.97e-36 123 52 1 123 3 rpsI Small ribosomal subunit protein uS9 Clavibacter sepedonicus
P66637 1.24e-35 122 50 1 125 3 rpsI Small ribosomal subunit protein uS9 Helicobacter pylori (strain ATCC 700392 / 26695)
P66638 1.24e-35 122 50 1 125 3 rpsI Small ribosomal subunit protein uS9 Helicobacter pylori (strain J99 / ATCC 700824)
B5Z683 1.24e-35 122 50 1 125 3 rpsI Small ribosomal subunit protein uS9 Helicobacter pylori (strain G27)
Q17VT4 1.27e-35 122 50 1 125 3 rpsI Small ribosomal subunit protein uS9 Helicobacter acinonychis (strain Sheeba)
B2URR4 1.3e-35 122 50 1 125 3 rpsI Small ribosomal subunit protein uS9 Helicobacter pylori (strain Shi470)
A1BHZ6 1.31e-35 122 50 0 122 3 rpsI Small ribosomal subunit protein uS9 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B6JPI5 1.41e-35 122 50 1 125 3 rpsI Small ribosomal subunit protein uS9 Helicobacter pylori (strain P12)
Q7NBH4 1.83e-35 121 50 0 130 3 rpsI Small ribosomal subunit protein uS9 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
A1SF28 1.99e-35 122 50 1 124 3 rpsI Small ribosomal subunit protein uS9 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q1CV71 2e-35 121 50 1 125 3 rpsI Small ribosomal subunit protein uS9 Helicobacter pylori (strain HPAG1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18260
Feature type CDS
Gene rpsI
Product 30S ribosomal protein S9
Location 4005520 - 4005912 (strand: 1)
Length 393 (nucleotides) / 130 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_717
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00380 Ribosomal protein S9/S16

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0103 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S9

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02996 small subunit ribosomal protein S9 Ribosome -

Protein Sequence

MADNQYYGTGRRKSSSARVFIKPGSGNIVINKRSLEVYFGRETARMVVRQPLELVDMLGKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRSDLRKAGFVTRDARSVERKKVGLRKARRRPQFSKR

Flanking regions ( +/- flanking 50bp)

ACGCGGCACAACAACCGCAAGTTCTGGACATTTAATCGGGATAATAGGCAATGGCTGATAATCAATACTACGGCACAGGTCGCCGCAAAAGTTCTTCCGCACGTGTCTTCATTAAGCCAGGTAGCGGTAATATCGTAATCAACAAACGTAGCCTTGAAGTTTACTTCGGCCGCGAAACAGCACGTATGGTTGTTCGTCAACCGCTGGAATTAGTTGATATGCTTGGTAAACTGGATTTATATATCACTGTTAAAGGTGGTGGTATCTCTGGTCAAGCAGGTGCGATTCGTCACGGTATCACTCGTGCACTGATGGAGTACGATGAGACTCTACGTTCTGATCTGCGTAAAGCTGGTTTCGTTACCCGTGATGCGCGTTCTGTTGAACGTAAAAAAGTGGGTCTGCGCAAAGCACGTCGTCGTCCACAGTTCTCAAAACGTTAATTTGTTATCTTTTAGATATCAATTTGATGTTGAAAAACCCGTCTTTACAG