Homologs in group_718

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03130 FBDBKF_03130 93.7 Morganella morganii S1 rplM 50S ribosomal protein L13
EHELCC_07405 EHELCC_07405 93.7 Morganella morganii S2 rplM 50S ribosomal protein L13
NLDBIP_07730 NLDBIP_07730 93.7 Morganella morganii S4 rplM 50S ribosomal protein L13
LHKJJB_07265 LHKJJB_07265 93.7 Morganella morganii S3 rplM 50S ribosomal protein L13
HKOGLL_03665 HKOGLL_03665 93.7 Morganella morganii S5 rplM 50S ribosomal protein L13
F4V73_RS11790 F4V73_RS11790 93.0 Morganella psychrotolerans rplM 50S ribosomal protein L13

Distribution of the homologs in the orthogroup group_718

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_718

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EXL9 6.19e-102 290 100 0 142 3 rplM Large ribosomal subunit protein uL13 Proteus mirabilis (strain HI4320)
A1JR94 1.73e-98 281 95 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N078 4.41e-97 278 92 0 142 3 rplM Large ribosomal subunit protein uL13 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GK03 6.13e-97 278 94 0 142 3 rplM Large ribosomal subunit protein uL13 Serratia proteamaculans (strain 568)
Q6DAE7 3.87e-96 276 92 0 142 3 rplM Large ribosomal subunit protein uL13 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JL66 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665K9 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THJ1 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis (strain Pestoides F)
Q1CE08 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1S0 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis bv. Antiqua (strain Angola)
Q0WB88 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis
B2K3Z7 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1H0 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDX4 5.21e-96 275 94 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P0AA15 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella flexneri
P0AA13 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA14 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella typhi
B4TWJ5 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella schwarzengrund (strain CVM19633)
B5BGQ0 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella paratyphi A (strain AKU_12601)
C0PZP0 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella paratyphi C (strain RKS4594)
A9N840 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJS5 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T755 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella newport (strain SL254)
B4TJR9 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella heidelberg (strain SL476)
B5REU3 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0L8 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella enteritidis PT4 (strain P125109)
B5FIS3 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella dublin (strain CT_02021853)
Q57JC3 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella choleraesuis (strain SC-B67)
A9MNY0 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7K5 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella agona (strain SL483)
B7LRJ9 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R6A9 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain UTI89 / UPEC)
B1LGJ7 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain SMS-3-5 / SECEC)
B6I1U9 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain SE11)
B7NDK9 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AA10 9.32e-96 275 93 0 142 1 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain K12)
B1IQP8 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AA11 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCN5 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGC4 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O1:K1 / APEC
A8A540 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O9:H4 (strain HS)
B1XHK4 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain K12 / DH10B)
C4ZSW9 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0U3 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O8 (strain IAI1)
B7N0L6 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O81 (strain ED1a)
B7NKU3 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YSV7 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AA12 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O157:H7
B7LHT9 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain 55989 / EAEC)
B7MBZ2 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJW3 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSC5 9.32e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O139:H28 (strain E24377A / ETEC)
C6DIQ1 1.54e-95 274 92 0 142 3 rplM Large ribosomal subunit protein uL13 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B2VGX3 1.9e-95 274 92 0 142 3 rplM Large ribosomal subunit protein uL13 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A7MJB9 2.47e-95 274 92 0 142 3 rplM Large ribosomal subunit protein uL13 Cronobacter sakazakii (strain ATCC BAA-894)
Q32BA8 3.92e-95 273 93 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella dysenteriae serotype 1 (strain Sd197)
Q31W99 8.74e-95 272 92 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella boydii serotype 4 (strain Sb227)
B2U1V4 8.74e-95 272 92 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A6TEN9 9.97e-95 272 92 0 142 3 rplM Large ribosomal subunit protein uL13 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSS1 9.97e-95 272 92 0 142 3 rplM Large ribosomal subunit protein uL13 Klebsiella pneumoniae (strain 342)
Q3YX17 1.03e-94 272 92 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella sonnei (strain Ss046)
A8AQC1 1.04e-94 272 92 0 142 3 rplM Large ribosomal subunit protein uL13 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q2NWI4 1.95e-94 271 91 0 142 3 rplM Large ribosomal subunit protein uL13 Sodalis glossinidius (strain morsitans)
C5B747 1.29e-93 269 91 0 142 3 rplM Large ribosomal subunit protein uL13 Edwardsiella ictaluri (strain 93-146)
Q0I2N3 1.13e-91 265 89 0 142 3 rplM Large ribosomal subunit protein uL13 Histophilus somni (strain 129Pt)
B0UTU4 5.93e-91 263 88 0 142 3 rplM Large ribosomal subunit protein uL13 Histophilus somni (strain 2336)
Q9CNB2 6e-91 263 89 0 142 3 rplM Large ribosomal subunit protein uL13 Pasteurella multocida (strain Pm70)
B8F3F6 2.88e-90 261 89 0 142 3 rplM Large ribosomal subunit protein uL13 Glaesserella parasuis serovar 5 (strain SH0165)
A5UC55 3.4e-90 261 89 0 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus influenzae (strain PittEE)
Q4QKH0 3.4e-90 261 89 0 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus influenzae (strain 86-028NP)
P31781 1.35e-89 259 88 0 142 3 rplM Large ribosomal subunit protein uL13 Histophilus somni
A6VPF5 1.69e-89 259 88 0 142 3 rplM Large ribosomal subunit protein uL13 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44387 1.76e-89 259 88 0 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UEW0 1.76e-89 259 88 0 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus influenzae (strain PittGG)
B0BUF9 1.92e-89 259 88 0 142 3 rplM Large ribosomal subunit protein uL13 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H129 1.92e-89 259 88 0 142 3 rplM Large ribosomal subunit protein uL13 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZW6 1.92e-89 259 88 0 142 3 rplM Large ribosomal subunit protein uL13 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65T20 4.78e-89 258 88 0 142 3 rplM Large ribosomal subunit protein uL13 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
C4K5S0 6.74e-87 252 84 0 142 3 rplM Large ribosomal subunit protein uL13 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q87SI5 3.1e-84 246 82 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6LMD4 7.97e-84 244 81 0 142 3 rplM Large ribosomal subunit protein uL13 Photobacterium profundum (strain SS9)
A7MWM9 1.05e-83 244 81 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio campbellii (strain ATCC BAA-1116)
B7VIY3 4.18e-83 243 81 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio atlanticus (strain LGP32)
Q7VLF6 6.06e-83 242 84 1 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q7MNX1 9e-83 242 81 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio vulnificus (strain YJ016)
Q8DEI9 9e-83 242 81 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio vulnificus (strain CMCP6)
C3LS60 2.39e-82 241 80 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUF1 2.39e-82 241 80 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F997 2.39e-82 241 80 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B5FB55 3.92e-82 240 80 0 142 3 rplM Large ribosomal subunit protein uL13 Aliivibrio fischeri (strain MJ11)
Q5E2M9 3.92e-82 240 80 0 142 3 rplM Large ribosomal subunit protein uL13 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4SHZ4 5.44e-82 240 80 0 142 3 rplM Large ribosomal subunit protein uL13 Aeromonas salmonicida (strain A449)
A1SYL6 2.05e-81 238 79 0 142 3 rplM Large ribosomal subunit protein uL13 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A0KPZ3 2.17e-81 238 80 0 142 3 rplM Large ribosomal subunit protein uL13 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A1SA67 2.88e-81 238 80 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
C4LCK7 3.44e-81 238 78 0 142 3 rplM Large ribosomal subunit protein uL13 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q07XR8 4.01e-81 238 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella frigidimarina (strain NCIMB 400)
A1RNJ8 5.95e-81 237 80 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella sp. (strain W3-18-1)
A4Y3E1 5.95e-81 237 80 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q0HYX5 6.56e-81 237 80 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella sp. (strain MR-7)
Q0HF30 6.56e-81 237 80 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella sp. (strain MR-4)
A0KT11 6.56e-81 237 80 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella sp. (strain ANA-3)
Q8EAG2 6.56e-81 237 80 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q5R0K6 7.74e-81 237 79 0 142 3 rplM Large ribosomal subunit protein uL13 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9L111 1.16e-80 236 79 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella baltica (strain OS195)
A3D8R4 1.16e-80 236 79 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E9M7 1.16e-80 236 79 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella baltica (strain OS223)
B6ELJ5 1.24e-80 236 78 0 142 3 rplM Large ribosomal subunit protein uL13 Aliivibrio salmonicida (strain LFI1238)
Q12RX8 1.82e-80 236 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A6WJ70 2.67e-80 236 79 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella baltica (strain OS185)
Q3IG26 3.59e-80 235 78 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudoalteromonas translucida (strain TAC 125)
B4RXK9 5.16e-80 235 78 0 142 3 rplM Large ribosomal subunit protein uL13 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q4K6H2 3.02e-78 231 78 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A6VXZ3 3.93e-78 230 76 0 142 3 rplM Large ribosomal subunit protein uL13 Marinomonas sp. (strain MWYL1)
Q3K723 5.05e-78 230 77 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas fluorescens (strain Pf0-1)
C1DQ78 5.76e-78 230 77 0 142 3 rplM Large ribosomal subunit protein uL13 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q1I596 1.24e-77 229 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas entomophila (strain L48)
Q4ZNX2 1.63e-77 229 77 0 140 3 rplM Large ribosomal subunit protein uL13 Pseudomonas syringae pv. syringae (strain B728a)
Q48EE0 1.63e-77 229 77 0 140 3 rplM Large ribosomal subunit protein uL13 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1J1W8 1.74e-77 229 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas putida (strain W619)
Q88N97 1.88e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KFU8 1.88e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas putida (strain GB-1)
A5W8S1 1.88e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4VIF7 2.56e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Stutzerimonas stutzeri (strain A1501)
A4XQQ3 3.72e-77 228 77 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas mendocina (strain ymp)
Q21FV8 4.43e-77 228 73 0 142 3 rplM Large ribosomal subunit protein uL13 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9HVY2 4.95e-77 228 76 0 142 1 rplM Large ribosomal subunit protein uL13 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02H07 4.95e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZL1 4.95e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas aeruginosa (strain LESB58)
A6VBA6 5.17e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas aeruginosa (strain PA7)
B2FJU4 7.93e-77 227 75 0 142 3 rplM Large ribosomal subunit protein uL13 Stenotrophomonas maltophilia (strain K279a)
Q0VS24 2.2e-76 226 73 0 142 3 rplM Large ribosomal subunit protein uL13 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q87WW7 2.25e-76 226 77 0 140 3 rplM Large ribosomal subunit protein uL13 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3BYA9 2.27e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q7CLV7 2.27e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RN05 2.27e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas campestris pv. campestris (strain B100)
Q4UZF2 2.27e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas campestris pv. campestris (strain 8004)
Q8NL21 2.27e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas axonopodis pv. citri (strain 306)
C3K6E1 2.65e-76 226 75 0 140 3 rplM Large ribosomal subunit protein uL13 Pseudomonas fluorescens (strain SBW25)
Q1QVF0 4.63e-76 225 76 0 142 3 rplM Large ribosomal subunit protein uL13 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5GV66 5e-76 225 73 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SL09 5e-76 225 73 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NYE3 5e-76 225 73 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q15PI3 1.19e-75 224 75 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q2S9X2 5.29e-75 222 73 0 142 3 rplM Large ribosomal subunit protein uL13 Hahella chejuensis (strain KCTC 2396)
B4SLE1 6.51e-75 222 73 0 142 3 rplM Large ribosomal subunit protein uL13 Stenotrophomonas maltophilia (strain R551-3)
Q0A6F3 7.59e-75 222 72 0 142 3 rplM Large ribosomal subunit protein uL13 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B8GNH1 9.45e-75 222 69 0 142 3 rplM Large ribosomal subunit protein uL13 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q6F898 2.65e-74 221 74 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C5BS66 3.8e-74 220 69 0 142 3 rplM Large ribosomal subunit protein uL13 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q60AF8 1.04e-73 219 71 0 142 3 rplM Large ribosomal subunit protein uL13 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q47VT1 2.2e-73 218 70 0 142 3 rplM Large ribosomal subunit protein uL13 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A5EXM0 3.12e-73 218 68 0 142 3 rplM Large ribosomal subunit protein uL13 Dichelobacter nodosus (strain VCS1703A)
Q87DD3 3.76e-73 218 73 0 142 3 rplM Large ribosomal subunit protein uL13 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U6Z6 3.76e-73 218 73 0 142 3 rplM Large ribosomal subunit protein uL13 Xylella fastidiosa (strain M12)
B2IAE8 3.76e-73 218 73 0 142 3 rplM Large ribosomal subunit protein uL13 Xylella fastidiosa (strain M23)
Q31IG6 4.34e-73 218 70 0 142 3 rplM Large ribosomal subunit protein uL13 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B3PBM0 6.09e-73 217 71 0 142 3 rplM Large ribosomal subunit protein uL13 Cellvibrio japonicus (strain Ueda107)
B0V669 1.13e-72 216 72 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain AYE)
A3M907 1.13e-72 216 72 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VV43 1.13e-72 216 72 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain SDF)
B2HZ29 1.13e-72 216 72 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain ACICU)
B7I9B0 1.13e-72 216 72 0 142 1 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain AB0057)
B7GWI2 1.13e-72 216 72 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain AB307-0294)
Q9PD42 1.82e-72 216 73 0 142 3 rplM Large ribosomal subunit protein uL13 Xylella fastidiosa (strain 9a5c)
A5IAL7 5.28e-72 215 72 0 142 3 rplM Large ribosomal subunit protein uL13 Legionella pneumophila (strain Corby)
Q5X1I1 5.28e-72 215 72 0 142 3 rplM Large ribosomal subunit protein uL13 Legionella pneumophila (strain Paris)
Q5WT90 8.1e-72 214 72 0 142 3 rplM Large ribosomal subunit protein uL13 Legionella pneumophila (strain Lens)
Q5ZS12 8.1e-72 214 72 0 142 3 rplM Large ribosomal subunit protein uL13 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q3J7B4 1.04e-71 214 69 0 142 3 rplM Large ribosomal subunit protein uL13 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
C1DDC6 3.72e-70 210 71 0 142 3 rplM Large ribosomal subunit protein uL13 Laribacter hongkongensis (strain HLHK9)
Q5P7T7 4.38e-70 210 70 0 142 3 rplM Large ribosomal subunit protein uL13 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B8D7S6 5.28e-70 210 66 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57471 5.28e-70 210 66 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9H4 5.28e-70 210 66 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B5EQH8 6.02e-70 209 66 0 142 3 rplM Large ribosomal subunit protein uL13 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JAI4 6.02e-70 209 66 0 142 3 rplM Large ribosomal subunit protein uL13 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q89AE6 1.33e-69 209 64 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1AXJ2 2.32e-69 208 66 0 142 3 rplM Large ribosomal subunit protein uL13 Ruthia magnifica subsp. Calyptogena magnifica
Q3SLK1 2.56e-69 208 69 0 142 3 rplM Large ribosomal subunit protein uL13 Thiobacillus denitrificans (strain ATCC 25259)
Q4FRE5 5.95e-69 207 69 0 142 3 rplM Large ribosomal subunit protein uL13 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q493Y6 6.42e-69 207 66 0 142 3 rplM Large ribosomal subunit protein uL13 Blochmanniella pennsylvanica (strain BPEN)
A1K971 2.27e-68 206 69 0 142 3 rplM Large ribosomal subunit protein uL13 Azoarcus sp. (strain BH72)
Q1LU54 2.39e-68 206 66 0 142 3 rplM Large ribosomal subunit protein uL13 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q1Q9X9 2.92e-68 205 67 0 142 3 rplM Large ribosomal subunit protein uL13 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q7NRT3 6.01e-68 204 69 0 142 3 rplM Large ribosomal subunit protein uL13 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q67JX6 6.49e-68 204 66 0 141 3 rplM Large ribosomal subunit protein uL13 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
A9I237 1.16e-67 204 66 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
B0TYE8 1.35e-67 204 66 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q5F5A5 1.38e-67 204 69 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q8K9F9 1.56e-67 203 63 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q475T3 1.74e-67 203 69 0 142 3 rplM Large ribosomal subunit protein uL13 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A4IX24 2.19e-67 203 65 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BLK8 2.19e-67 203 65 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q7F4 2.19e-67 203 65 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. novicida (strain U112)
B2SGW2 2.19e-67 203 65 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A332 2.19e-67 203 65 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. holarctica (strain LVS)
B2AH57 2.24e-67 203 69 0 142 3 rplM Large ribosomal subunit protein uL13 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0KED9 2.24e-67 203 69 0 142 3 rplM Large ribosomal subunit protein uL13 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A5WDK9 2.37e-67 203 68 0 142 3 rplM Large ribosomal subunit protein uL13 Psychrobacter sp. (strain PRwf-1)
Q1LRD0 2.7e-67 203 68 0 142 3 rplM Large ribosomal subunit protein uL13 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A5CVT9 3.32e-67 202 64 0 142 3 rplM Large ribosomal subunit protein uL13 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A7NCM5 3.4e-67 202 64 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q2KV01 4.82e-67 202 66 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella avium (strain 197N)
A1KWD6 5.21e-67 202 68 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DD49 5.21e-67 202 68 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JQM8 5.21e-67 202 68 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M087 5.21e-67 202 68 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria meningitidis serogroup C (strain 053442)
C4ZI85 2.12e-66 201 64 0 142 3 rplM Large ribosomal subunit protein uL13 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q7VUV8 3.51e-66 200 65 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z1 3.51e-66 200 65 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC3 3.51e-66 200 65 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q47IC5 1.78e-65 198 64 0 142 3 rplM Large ribosomal subunit protein uL13 Dechloromonas aromatica (strain RCB)
A9KJF5 2.16e-65 198 62 0 142 3 rplM Large ribosomal subunit protein uL13 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q8Y246 4.97e-65 197 66 0 142 3 rplM Large ribosomal subunit protein uL13 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2UFK1 8.89e-65 196 66 0 142 3 rplM Large ribosomal subunit protein uL13 Ralstonia pickettii (strain 12J)
Q1GXB2 1.57e-64 196 67 0 142 3 rplM Large ribosomal subunit protein uL13 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2YBK2 3.06e-64 195 64 0 142 3 rplM Large ribosomal subunit protein uL13 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q0AI00 3.98e-64 195 66 0 142 3 rplM Large ribosomal subunit protein uL13 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1VJJ3 6.66e-64 194 63 0 142 3 rplM Large ribosomal subunit protein uL13 Polaromonas naphthalenivorans (strain CJ2)
Q2SZ69 7.87e-64 194 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW3 7.87e-64 194 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia pseudomallei (strain K96243)
A3NDG8 7.87e-64 194 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia pseudomallei (strain 668)
Q3JNR1 7.87e-64 194 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia pseudomallei (strain 1710b)
A3NZ80 7.87e-64 194 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia pseudomallei (strain 1106a)
Q124N6 8.87e-64 194 64 0 142 3 rplM Large ribosomal subunit protein uL13 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A4JBK4 1.15e-63 194 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BZ45 1.15e-63 194 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia orbicola (strain AU 1054)
B1JVU4 1.15e-63 194 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia orbicola (strain MC0-3)
Q39JK0 1.15e-63 194 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BI91 1.15e-63 194 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4EET6 1.15e-63 194 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A9C179 1.36e-63 193 63 0 142 3 rplM Large ribosomal subunit protein uL13 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q30Y43 2.18e-63 193 61 0 142 3 rplM Large ribosomal subunit protein uL13 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q82UK0 2.74e-63 193 66 0 142 3 rplM Large ribosomal subunit protein uL13 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1W3P7 4.74e-63 192 63 0 142 3 rplM Large ribosomal subunit protein uL13 Acidovorax sp. (strain JS42)
B9MD52 4.74e-63 192 63 0 142 3 rplM Large ribosomal subunit protein uL13 Acidovorax ebreus (strain TPSY)
Q13UB2 5.59e-63 192 65 0 142 3 rplM Large ribosomal subunit protein uL13 Paraburkholderia xenovorans (strain LB400)
B2SYL0 5.59e-63 192 65 0 142 3 rplM Large ribosomal subunit protein uL13 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1V051 7.35e-63 192 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia mallei (strain SAVP1)
Q62HC0 7.35e-63 192 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia mallei (strain ATCC 23344)
A2S581 7.35e-63 192 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia mallei (strain NCTC 10229)
A3MP59 7.35e-63 192 64 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia mallei (strain NCTC 10247)
A1TUF6 1.19e-62 191 62 0 142 3 rplM Large ribosomal subunit protein uL13 Paracidovorax citrulli (strain AAC00-1)
B1Y3K7 1.69e-62 191 64 0 142 3 rplM Large ribosomal subunit protein uL13 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B8DPL7 1.78e-62 191 61 0 142 3 rplM Large ribosomal subunit protein uL13 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A1WL74 3.44e-62 190 62 0 142 3 rplM Large ribosomal subunit protein uL13 Verminephrobacter eiseniae (strain EF01-2)
C4KZL3 3.52e-62 190 58 0 140 3 rplM Large ribosomal subunit protein uL13 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
C5CM24 3.64e-62 190 63 0 141 3 rplM Large ribosomal subunit protein uL13 Variovorax paradoxus (strain S110)
B8I815 3.68e-62 190 61 0 142 3 rplM Large ribosomal subunit protein uL13 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A1WYS9 6.16e-62 189 63 0 142 3 rplM Large ribosomal subunit protein uL13 Halorhodospira halophila (strain DSM 244 / SL1)
A8F9B8 8.35e-62 189 62 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus pumilus (strain SAFR-032)
A4G1T2 9.86e-62 189 63 0 142 3 rplM Large ribosomal subunit protein uL13 Herminiimonas arsenicoxydans
A6SUN7 1.2e-61 189 63 0 142 3 rplM Large ribosomal subunit protein uL13 Janthinobacterium sp. (strain Marseille)
B5YDX6 1.92e-61 188 62 0 142 3 rplM Large ribosomal subunit protein uL13 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q220T2 2.17e-61 188 61 0 141 3 rplM Large ribosomal subunit protein uL13 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B8E1G6 2.53e-61 188 62 0 142 3 rplM Large ribosomal subunit protein uL13 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q5WLM9 4.51e-61 187 60 0 140 3 rplM Large ribosomal subunit protein uL13 Shouchella clausii (strain KSM-K16)
Q3A3B6 8.17e-61 186 61 0 142 3 rplM Large ribosomal subunit protein uL13 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A9VPB0 1.28e-60 186 61 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus mycoides (strain KBAB4)
B1XS32 1.58e-60 186 61 0 142 3 rplM Large ribosomal subunit protein uL13 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4T034 1.58e-60 186 61 0 142 3 rplM Large ribosomal subunit protein uL13 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A7GK53 1.61e-60 186 62 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2LPM2 2.1e-60 186 60 0 142 3 rplM Large ribosomal subunit protein uL13 Syntrophus aciditrophicus (strain SB)
A8MLH5 5.86e-60 184 60 0 142 3 rplM Large ribosomal subunit protein uL13 Alkaliphilus oremlandii (strain OhILAs)
C6C1J9 6.48e-60 184 59 0 142 3 rplM Large ribosomal subunit protein uL13 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
Q83AX8 6.99e-60 184 56 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAB1 6.99e-60 184 56 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KBY0 6.99e-60 184 56 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain Dugway 5J108-111)
B6J4G5 6.99e-60 184 56 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain CbuK_Q154)
Q9KGD5 8.97e-60 184 59 0 140 3 rplM Large ribosomal subunit protein uL13 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B6J2V1 1.08e-59 184 55 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain CbuG_Q212)
C5C020 1.14e-59 184 57 0 142 3 rplM Large ribosomal subunit protein uL13 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q8ETV4 5.35e-59 182 59 0 140 3 rplM Large ribosomal subunit protein uL13 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B7IT52 5.47e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain G9842)
A7Z0S1 6.23e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A9NEI3 6.25e-59 182 57 0 142 3 rplM Large ribosomal subunit protein uL13 Acholeplasma laidlawii (strain PG-8A)
Q6HPM6 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81J13 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZM7 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain Q1)
B7HQX7 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain AH187)
B7HJJ0 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain B4264)
C1ET72 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain 03BB102)
Q73F63 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKF3 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain AH820)
Q81VP9 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus anthracis
A0R8L2 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus thuringiensis (strain Al Hakam)
C3LJX7 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAK3 6.73e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus anthracis (strain A0248)
B1XJI1 6.92e-59 182 62 0 142 3 rplM Large ribosomal subunit protein uL13 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
A1VBD3 7.04e-59 182 57 0 142 3 rplM Large ribosomal subunit protein uL13 Nitratidesulfovibrio vulgaris (strain DP4)
Q728T4 7.04e-59 182 57 0 142 3 rplM Large ribosomal subunit protein uL13 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C0ZIL3 1.04e-58 181 59 0 140 3 rplM Large ribosomal subunit protein uL13 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
C4XNQ2 1.07e-58 181 58 0 142 3 rplM Large ribosomal subunit protein uL13 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
C4Z2W3 1.25e-58 181 60 0 140 3 rplM Large ribosomal subunit protein uL13 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
B2A4Q6 1.69e-58 181 63 0 136 3 rplM Large ribosomal subunit protein uL13 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q3MF94 1.72e-58 181 61 0 141 3 rplM Large ribosomal subunit protein uL13 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q65P73 2.35e-58 180 59 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P70974 2.7e-58 180 59 0 140 1 rplM Large ribosomal subunit protein uL13 Bacillus subtilis (strain 168)
Q1MQW4 2.8e-58 180 57 0 142 3 rplM Large ribosomal subunit protein uL13 Lawsonia intracellularis (strain PHE/MN1-00)
B1YH84 3.08e-58 180 56 0 140 3 rplM Large ribosomal subunit protein uL13 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B8IZP2 4.24e-58 180 57 0 142 3 rplM Large ribosomal subunit protein uL13 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q5N0T9 4.36e-58 180 61 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31L33 4.36e-58 180 61 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B0K5S7 4.43e-58 179 59 0 142 3 rplM Large ribosomal subunit protein uL13 Thermoanaerobacter sp. (strain X514)
B0KCN4 4.43e-58 179 59 0 142 3 rplM Large ribosomal subunit protein uL13 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q7V9Y8 7.21e-58 179 56 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A6TWE7 8.65e-58 179 59 0 142 3 rplM Large ribosomal subunit protein uL13 Alkaliphilus metalliredigens (strain QYMF)
A0ALT3 9.12e-58 179 54 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Y458 9.12e-58 179 54 0 140 1 rplM Large ribosomal subunit protein uL13 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB43 9.12e-58 179 54 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WI1 9.12e-58 179 54 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria monocytogenes serotype 4b (strain F2365)
C1KZ12 9.12e-58 179 54 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8YPK6 1.33e-57 179 60 0 141 3 rplM Large ribosomal subunit protein uL13 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q6ANL8 1.43e-57 178 57 0 142 3 rplM Large ribosomal subunit protein uL13 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A8G736 1.9e-57 178 60 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9215)
A4IJM0 2.5e-57 178 60 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacillus thermodenitrificans (strain NG80-2)
B7KI14 2.57e-57 178 59 0 141 3 rplM Large ribosomal subunit protein uL13 Gloeothece citriformis (strain PCC 7424)
A0L480 2.88e-57 177 58 1 143 3 rplM Large ribosomal subunit protein uL13 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A2BYR0 3.18e-57 177 60 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9515)
A2BTB2 3.25e-57 177 60 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain AS9601)
Q890R6 3.75e-57 177 57 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium tetani (strain Massachusetts / E88)
Q6H001 4.63e-57 177 58 0 141 3 rplM Large ribosomal subunit protein uL13 Microchaete diplosiphon
Q927P2 5.14e-57 177 53 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B7K221 5.4e-57 177 58 0 139 3 rplM Large ribosomal subunit protein uL13 Rippkaea orientalis (strain PCC 8801 / RF-1)
Q7U4H5 5.71e-57 177 56 0 141 3 rplM Large ribosomal subunit protein uL13 Parasynechococcus marenigrum (strain WH8102)
Q63H58 6.69e-57 177 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain ZK / E33L)
A3PF22 6.92e-57 176 60 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9301)
B0JY35 8.19e-57 177 61 0 141 3 rplM Large ribosomal subunit protein uL13 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A5GVY6 9.34e-57 176 59 0 137 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain RCC307)
Q057I8 1.09e-56 176 52 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B9E9M3 1.19e-56 176 53 0 141 3 rplM Large ribosomal subunit protein uL13 Macrococcus caseolyticus (strain JCSC5402)
Q2RFT2 1.21e-56 176 59 0 142 3 rplM Large ribosomal subunit protein uL13 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q318L0 1.26e-56 176 58 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9312)
Q8UFZ7 1.78e-56 176 58 1 143 3 rplM Large ribosomal subunit protein uL13 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q982W8 1.81e-56 176 59 1 143 3 rplM Large ribosomal subunit protein uL13 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C5D3V0 1.83e-56 176 58 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacillus sp. (strain WCH70)
Q5L3Q6 1.91e-56 176 60 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacillus kaustophilus (strain HTA426)
B8G6P5 2.36e-56 175 55 0 138 3 rplM Large ribosomal subunit protein uL13 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q7A089 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain MW2)
A8Z325 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G7A3 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain MSSA476)
Q6GEL7 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain MRSA252)
Q7A473 2.41e-56 175 57 0 141 1 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain N315)
Q99S51 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ60 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain Newman)
Q5HDZ0 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain COL)
Q2YYM8 2.41e-56 175 57 0 141 1 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV02 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain JH9)
Q2FW38 2.41e-56 175 57 0 141 1 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FES1 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain USA300)
A6U3U3 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain JH1)
A7X5B4 2.41e-56 175 57 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain Mu3 / ATCC 700698)
A7NR33 2.46e-56 175 56 0 141 3 rplM Large ribosomal subunit protein uL13 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q7UZW8 2.81e-56 175 58 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A4XBI7 3.16e-56 175 55 0 142 3 rplM Large ribosomal subunit protein uL13 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8M4C0 3.16e-56 175 55 0 142 3 rplM Large ribosomal subunit protein uL13 Salinispora arenicola (strain CNS-205)
Q8DMK8 3.62e-56 175 65 0 128 3 rplM Large ribosomal subunit protein uL13 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B4SEC9 3.92e-56 175 57 0 137 3 rplM Large ribosomal subunit protein uL13 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
P73294 4.47e-56 175 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8R7Y8 5.25e-56 174 57 0 142 3 rplM Large ribosomal subunit protein uL13 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
B9LJG2 6.04e-56 174 56 0 138 3 rplM Large ribosomal subunit protein uL13 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH96 6.04e-56 174 56 0 138 3 rplM Large ribosomal subunit protein uL13 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q0ID31 6.34e-56 174 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain CC9311)
A5GIR9 6.48e-56 174 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain WH7803)
Q2IWN7 6.6e-56 174 58 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain HaA2)
Q4L881 6.81e-56 174 54 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus haemolyticus (strain JCSC1435)
Q3AW67 7.98e-56 174 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain CC9902)
Q00990 8.39e-56 174 55 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus carnosus (strain TM300)
A6X1V4 9.68e-56 174 56 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
A1ATL1 1.06e-55 174 58 0 142 3 rplM Large ribosomal subunit protein uL13 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B3EA22 1.19e-55 173 57 0 142 3 rplM Large ribosomal subunit protein uL13 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
B2GDT7 1.38e-55 173 58 0 140 3 rplM Large ribosomal subunit protein uL13 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q748X4 1.47e-55 173 61 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q136Q3 1.52e-55 174 58 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain BisB5)
Q6G3I6 1.71e-55 173 55 1 143 3 rplM Large ribosomal subunit protein uL13 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A6U7T7 1.81e-55 173 59 1 143 3 rplM Large ribosomal subunit protein uL13 Sinorhizobium medicae (strain WSM419)
Q92QR4 1.87e-55 173 59 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium meliloti (strain 1021)
C6E4S8 1.91e-55 173 57 0 142 3 rplM Large ribosomal subunit protein uL13 Geobacter sp. (strain M21)
Q2JUJ8 2.66e-55 173 61 0 140 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain JA-3-3Ab)
A9IVX4 3.37e-55 172 55 1 143 3 rplM Large ribosomal subunit protein uL13 Bartonella tribocorum (strain CIP 105476 / IBS 506)
A6W5X0 3.59e-55 172 55 0 142 3 rplM Large ribosomal subunit protein uL13 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q1MIP2 4.06e-55 172 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q46IT5 5.13e-55 172 53 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain NATL2A)
A2C4X4 5.13e-55 172 53 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain NATL1A)
Q2S6I8 5.14e-55 172 58 0 141 3 rplM Large ribosomal subunit protein uL13 Salinibacter ruber (strain DSM 13855 / M31)
B1LBJ2 6.25e-55 172 58 0 141 3 rplM Large ribosomal subunit protein uL13 Thermotoga sp. (strain RQ2)
A5IMD1 6.25e-55 172 58 0 141 3 rplM Large ribosomal subunit protein uL13 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1G5 6.25e-55 172 58 0 141 3 rplM Large ribosomal subunit protein uL13 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
B9JD18 6.29e-55 172 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A5USF9 6.42e-55 172 54 0 141 3 rplM Large ribosomal subunit protein uL13 Roseiflexus sp. (strain RS-1)
Q8G1C8 6.64e-55 172 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella suis biovar 1 (strain 1330)
B0CLB8 6.64e-55 172 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VPX5 6.64e-55 172 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
B3PVW4 6.71e-55 172 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium etli (strain CIAT 652)
Q3AMQ6 7.05e-55 172 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain CC9605)
B6JGT5 7.09e-55 172 55 1 143 3 rplM Large ribosomal subunit protein uL13 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B5EFM9 7.76e-55 171 56 0 142 3 rplM Large ribosomal subunit protein uL13 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q3B5U2 8.13e-55 171 54 0 142 3 rplM Large ribosomal subunit protein uL13 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q2JL71 8.2e-55 172 59 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain JA-2-3B'a(2-13))
B3QKG3 8.92e-55 172 56 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain TIE-1)
Q6N651 8.92e-55 172 56 1 143 1 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q49ZD6 9.32e-55 171 55 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B3EMI6 9.57e-55 171 56 0 137 3 rplM Large ribosomal subunit protein uL13 Chlorobium phaeobacteroides (strain BS1)
B4S432 1.06e-54 171 53 0 142 3 rplM Large ribosomal subunit protein uL13 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A1UT83 1.06e-54 171 56 1 143 3 rplM Large ribosomal subunit protein uL13 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
B5ZXZ6 1.14e-54 171 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B0C427 1.22e-54 171 58 0 141 3 rplM Large ribosomal subunit protein uL13 Acaryochloris marina (strain MBIC 11017)
C3MA33 1.31e-54 171 58 1 143 3 rplM Large ribosomal subunit protein uL13 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7V521 1.77e-54 171 52 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9313)
A2CC54 1.77e-54 171 52 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9303)
Q2K9W3 1.84e-54 171 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
O67722 1.99e-54 170 58 0 142 3 rplM Large ribosomal subunit protein uL13 Aquifex aeolicus (strain VF5)
Q6FZQ6 2.19e-54 171 55 1 143 3 rplM Large ribosomal subunit protein uL13 Bartonella quintana (strain Toulouse)
B8HMT1 3.02e-54 170 58 0 141 3 rplM Large ribosomal subunit protein uL13 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q53874 3.86e-54 170 53 0 142 3 rplM Large ribosomal subunit protein uL13 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B1WQT8 4.88e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Crocosphaera subtropica (strain ATCC 51142 / BH68)
C1A3Z5 5.52e-54 169 57 1 143 3 rplM Large ribosomal subunit protein uL13 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
B9JVC5 5.67e-54 169 58 1 143 3 rplM Large ribosomal subunit protein uL13 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A4FPH1 6.03e-54 169 54 0 142 3 rplM Large ribosomal subunit protein uL13 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
A9MAG8 7.06e-54 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q5HM31 7.21e-54 169 53 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
A8I7Z7 7.71e-54 169 58 1 143 3 rplM Large ribosomal subunit protein uL13 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
A1BHZ7 8.01e-54 169 54 0 137 3 rplM Large ribosomal subunit protein uL13 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q8YGJ1 8.5e-54 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57DW1 8.5e-54 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella abortus biovar 1 (strain 9-941)
Q2YND8 8.5e-54 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella abortus (strain 2308)
B2S536 8.5e-54 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella abortus (strain S19)
Q39Y25 9.2e-54 169 58 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q214E1 9.48e-54 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain BisB18)
Q11J65 1.11e-53 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Chelativorans sp. (strain BNC1)
Q2W1B4 1.14e-53 169 56 1 143 3 rplM Large ribosomal subunit protein uL13 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q47LM5 1.19e-53 169 54 0 142 3 rplM Large ribosomal subunit protein uL13 Thermobifida fusca (strain YX)
B6IMQ3 1.67e-53 168 55 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodospirillum centenum (strain ATCC 51521 / SW)
A4J152 1.77e-53 168 54 0 140 3 rplM Large ribosomal subunit protein uL13 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q3AQ23 1.99e-53 168 54 0 142 3 rplM Large ribosomal subunit protein uL13 Chlorobium chlorochromatii (strain CaD3)
Q8KBK4 2.52e-53 168 52 0 142 3 rplM Large ribosomal subunit protein uL13 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B1W3X5 2.56e-53 167 52 0 142 3 rplM Large ribosomal subunit protein uL13 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q0AUL5 2.74e-53 167 52 0 142 3 rplM Large ribosomal subunit protein uL13 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B8IUE9 3.03e-53 167 55 1 143 3 rplM Large ribosomal subunit protein uL13 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q1WSC2 3.37e-53 167 57 0 140 3 rplM Large ribosomal subunit protein uL13 Ligilactobacillus salivarius (strain UCC118)
C0RIC6 3.48e-53 167 54 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella melitensis biotype 2 (strain ATCC 23457)
Q82DL9 4.99e-53 167 51 0 142 3 rplM Large ribosomal subunit protein uL13 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
P60488 5.15e-53 167 54 1 142 1 rplM Large ribosomal subunit protein uL13 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IN1 5.15e-53 167 54 1 142 1 rplM Large ribosomal subunit protein uL13 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q8CRI9 5.23e-53 167 52 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
B2TIL0 5.78e-53 167 54 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYE5 5.78e-53 167 54 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium botulinum (strain Alaska E43 / Type E3)
Q38UV4 7.24e-53 166 57 0 140 3 rplM Large ribosomal subunit protein uL13 Latilactobacillus sakei subsp. sakei (strain 23K)
B0UQW6 7.34e-53 167 55 1 143 3 rplM Large ribosomal subunit protein uL13 Methylobacterium sp. (strain 4-46)
Q03PY9 7.73e-53 166 56 0 140 3 rplM Large ribosomal subunit protein uL13 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A5D5F6 9.56e-53 166 58 1 139 3 rplM Large ribosomal subunit protein uL13 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q73PE7 1.09e-52 166 52 0 142 3 rplM Large ribosomal subunit protein uL13 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
P51292 1.33e-52 166 56 0 126 3 rpl13 Large ribosomal subunit protein uL13c Porphyra purpurea
B8FW04 1.48e-52 166 56 0 142 3 rplM Large ribosomal subunit protein uL13 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
C1F3Z9 1.69e-52 166 54 0 142 3 rplM Large ribosomal subunit protein uL13 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A4SDB9 1.91e-52 166 55 0 137 3 rplM Large ribosomal subunit protein uL13 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q03EE8 2.16e-52 165 57 0 140 3 rplM Large ribosomal subunit protein uL13 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q0API1 3.43e-52 165 56 2 144 3 rplM Large ribosomal subunit protein uL13 Maricaulis maris (strain MCS10)
Q8D361 3.45e-52 165 50 0 140 3 rplM Large ribosomal subunit protein uL13 Wigglesworthia glossinidia brevipalpis
B1KSJ0 4.14e-52 164 55 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium botulinum (strain Loch Maree / Type A3)
A7FZ38 4.14e-52 164 55 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium botulinum (strain ATCC 19397 / Type A)
Q2RSE3 4.31e-52 165 55 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B0TC91 4.72e-52 164 55 0 142 3 rplM Large ribosomal subunit protein uL13 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A0LIV4 5e-52 164 54 0 137 3 rplM Large ribosomal subunit protein uL13 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A9BHB6 5.33e-52 164 49 0 140 3 rplM Large ribosomal subunit protein uL13 Petrotoga mobilis (strain DSM 10674 / SJ95)
A0PXY1 6.27e-52 164 52 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium novyi (strain NT)
B7ICN0 6.3e-52 164 52 0 141 3 rplM Large ribosomal subunit protein uL13 Thermosipho africanus (strain TCF52B)
Q24ZM6 7.01e-52 164 55 0 142 3 rplM Large ribosomal subunit protein uL13 Desulfitobacterium hafniense (strain Y51)
B1ZCB3 8.23e-52 164 56 1 143 3 rplM Large ribosomal subunit protein uL13 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B2GJ23 1.02e-51 164 54 0 138 3 rplM Large ribosomal subunit protein uL13 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
B3EFY2 1.12e-51 164 53 0 142 3 rplM Large ribosomal subunit protein uL13 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B2G8U6 1.14e-51 164 55 0 140 3 rplM Large ribosomal subunit protein uL13 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLH3 1.14e-51 164 55 0 140 3 rplM Large ribosomal subunit protein uL13 Limosilactobacillus reuteri (strain DSM 20016)
A5N4T1 1.26e-51 163 53 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYE3 1.26e-51 163 53 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium kluyveri (strain NBRC 12016)
B3QLF5 1.35e-51 163 54 0 137 3 rplM Large ribosomal subunit protein uL13 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q0SQH8 1.52e-51 163 52 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium perfringens (strain SM101 / Type A)
Q8XHV6 1.52e-51 163 52 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium perfringens (strain 13 / Type A)
A8LKY0 1.7e-51 163 55 2 143 3 rplM Large ribosomal subunit protein uL13 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B1M200 2.06e-51 163 56 1 143 3 rplM Large ribosomal subunit protein uL13 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A6Q5F7 2.08e-51 162 57 1 133 3 rplM Large ribosomal subunit protein uL13 Nitratiruptor sp. (strain SB155-2)
Q74L58 2.25e-51 163 53 0 140 3 rplM Large ribosomal subunit protein uL13 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
B9MLF7 5.61e-51 162 56 0 142 3 rplM Large ribosomal subunit protein uL13 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
C0R579 5.78e-51 162 51 1 143 3 rplM Large ribosomal subunit protein uL13 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q110D4 6.38e-51 162 54 0 141 3 rplM Large ribosomal subunit protein uL13 Trichodesmium erythraeum (strain IMS101)
Q89KE4 7.91e-51 162 53 1 143 3 rplM Large ribosomal subunit protein uL13 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A4XJ59 8.05e-51 161 56 0 142 3 rplM Large ribosomal subunit protein uL13 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B2URH4 8.6e-51 161 54 0 142 3 rplM Large ribosomal subunit protein uL13 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A9B440 9.88e-51 161 52 0 142 3 rplM Large ribosomal subunit protein uL13 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q0TMT1 1.06e-50 161 52 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q6A6T3 1.07e-50 161 52 0 142 1 rplM Large ribosomal subunit protein uL13 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q1XDJ6 1.23e-50 160 56 0 124 3 rpl13 Large ribosomal subunit protein uL13c Neopyropia yezoensis
A9W605 1.44e-50 161 55 1 143 3 rplM Large ribosomal subunit protein uL13 Methylorubrum extorquens (strain PA1)
B7KPU5 1.44e-50 161 55 1 143 3 rplM Large ribosomal subunit protein uL13 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B1MG81 1.65e-50 160 53 0 142 3 rplM Large ribosomal subunit protein uL13 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q73IT2 1.67e-50 160 51 1 143 3 rplM Large ribosomal subunit protein uL13 Wolbachia pipientis wMel
Q0S3D9 1.68e-50 160 52 0 142 3 rplM Large ribosomal subunit protein uL13 Rhodococcus jostii (strain RHA1)
Q5Z1I0 1.94e-50 160 53 0 142 3 rplM Large ribosomal subunit protein uL13 Nocardia farcinica (strain IFM 10152)
Q3A9V1 1.95e-50 160 52 0 140 3 rplM Large ribosomal subunit protein uL13 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18255
Feature type CDS
Gene rplM
Product 50S ribosomal protein L13
Location 4005076 - 4005504 (strand: 1)
Length 429 (nucleotides) / 142 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_718
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00572 Ribosomal protein L13

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0102 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L13

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02871 large subunit ribosomal protein L13 Ribosome -

Protein Sequence

MKTFTAKPETVKRDWYVVDADGKTLGRLATEIARRLRGKHKAEYTPHVDTGDYIIVLNAEKVAVTGHKRTDKVYYRHTGHVGGIKQATFEEMIARSPERVIEIAVKGMLPKGPLGRAMYRKLKVYAGAEHNHAAQQPQVLDI

Flanking regions ( +/- flanking 50bp)

TGAACCGAGTGTTCACCAACGTGTAACTAAACATTGGGTAATTTTCAATAATGAAAACTTTTACAGCTAAACCAGAAACCGTAAAACGCGACTGGTATGTTGTTGATGCAGACGGCAAAACTTTAGGTCGTTTAGCAACTGAAATCGCACGCCGTTTACGCGGTAAACATAAAGCGGAATACACTCCGCACGTTGATACTGGTGACTACATCATCGTTTTAAACGCTGAGAAAGTAGCGGTAACTGGTCATAAACGTACTGACAAAGTTTACTACCGTCATACTGGTCACGTAGGTGGTATCAAGCAAGCGACTTTCGAAGAGATGATCGCCCGTAGTCCTGAGCGTGTAATCGAAATCGCGGTAAAAGGCATGCTGCCAAAAGGGCCTCTGGGTCGTGCTATGTACCGTAAACTGAAAGTTTACGCAGGCGCTGAGCACAACCACGCGGCACAACAACCGCAAGTTCTGGACATTTAATCGGGATAATAGGCAATGGCTGATAATCAATACTACGGCACAGGTCGCCG