Homologs in group_789

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03130 FBDBKF_03130 100.0 Morganella morganii S1 rplM 50S ribosomal protein L13
EHELCC_07405 EHELCC_07405 100.0 Morganella morganii S2 rplM 50S ribosomal protein L13
LHKJJB_07265 LHKJJB_07265 100.0 Morganella morganii S3 rplM 50S ribosomal protein L13
HKOGLL_03665 HKOGLL_03665 100.0 Morganella morganii S5 rplM 50S ribosomal protein L13
F4V73_RS11790 F4V73_RS11790 98.6 Morganella psychrotolerans rplM 50S ribosomal protein L13
PMI_RS18255 PMI_RS18255 93.7 Proteus mirabilis HI4320 rplM 50S ribosomal protein L13

Distribution of the homologs in the orthogroup group_789

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_789

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B2VGX3 1.29e-98 282 95 0 142 3 rplM Large ribosomal subunit protein uL13 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GK03 1.47e-97 279 95 0 142 3 rplM Large ribosomal subunit protein uL13 Serratia proteamaculans (strain 568)
B1JL66 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665K9 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THJ1 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis (strain Pestoides F)
Q1CE08 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R1S0 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis bv. Antiqua (strain Angola)
Q0WB88 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis
B2K3Z7 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C1H0 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FDX4 5.99e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
P0AA15 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella flexneri
P0AA13 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0AA14 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella typhi
B4TWJ5 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella schwarzengrund (strain CVM19633)
B5BGQ0 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella paratyphi A (strain AKU_12601)
C0PZP0 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella paratyphi C (strain RKS4594)
A9N840 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJS5 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T755 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella newport (strain SL254)
B4TJR9 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella heidelberg (strain SL476)
B5REU3 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0L8 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella enteritidis PT4 (strain P125109)
B5FIS3 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella dublin (strain CT_02021853)
Q57JC3 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella choleraesuis (strain SC-B67)
A9MNY0 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F7K5 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Salmonella agona (strain SL483)
B7LRJ9 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1R6A9 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain UTI89 / UPEC)
B1LGJ7 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain SMS-3-5 / SECEC)
B6I1U9 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain SE11)
B7NDK9 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0AA10 6.06e-97 278 93 0 142 1 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain K12)
B1IQP8 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0AA11 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCN5 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGC4 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O1:K1 / APEC
A8A540 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O9:H4 (strain HS)
B1XHK4 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain K12 / DH10B)
C4ZSW9 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M0U3 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O8 (strain IAI1)
B7N0L6 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O81 (strain ED1a)
B7NKU3 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YSV7 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0AA12 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O157:H7
B7LHT9 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli (strain 55989 / EAEC)
B7MBZ2 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJW3 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSC5 6.06e-97 278 93 0 142 3 rplM Large ribosomal subunit protein uL13 Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MJB9 1.41e-96 277 92 0 142 3 rplM Large ribosomal subunit protein uL13 Cronobacter sakazakii (strain ATCC BAA-894)
A1JR94 1.47e-96 277 92 0 142 3 rplM Large ribosomal subunit protein uL13 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q32BA8 2.58e-96 276 93 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella dysenteriae serotype 1 (strain Sd197)
A6TEN9 4.37e-96 276 92 0 142 3 rplM Large ribosomal subunit protein uL13 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XSS1 4.37e-96 276 92 0 142 3 rplM Large ribosomal subunit protein uL13 Klebsiella pneumoniae (strain 342)
Q31W99 6.42e-96 275 92 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella boydii serotype 4 (strain Sb227)
B2U1V4 6.42e-96 275 92 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A8AQC1 6.63e-96 275 92 0 142 3 rplM Large ribosomal subunit protein uL13 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q3YX17 6.7e-96 275 92 0 142 3 rplM Large ribosomal subunit protein uL13 Shigella sonnei (strain Ss046)
B4EXL9 8.92e-96 275 93 0 142 3 rplM Large ribosomal subunit protein uL13 Proteus mirabilis (strain HI4320)
C5B747 1.63e-95 274 91 0 142 3 rplM Large ribosomal subunit protein uL13 Edwardsiella ictaluri (strain 93-146)
Q6DAE7 3.84e-95 273 91 0 142 3 rplM Large ribosomal subunit protein uL13 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7N078 1.55e-94 271 90 0 142 3 rplM Large ribosomal subunit protein uL13 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DIQ1 2.15e-94 271 90 0 142 3 rplM Large ribosomal subunit protein uL13 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q0I2N3 2.8e-93 268 90 0 142 3 rplM Large ribosomal subunit protein uL13 Histophilus somni (strain 129Pt)
Q2NWI4 3.3e-93 268 90 0 142 3 rplM Large ribosomal subunit protein uL13 Sodalis glossinidius (strain morsitans)
Q9CNB2 9.69e-93 267 90 0 142 3 rplM Large ribosomal subunit protein uL13 Pasteurella multocida (strain Pm70)
B0UTU4 1.45e-92 267 89 0 142 3 rplM Large ribosomal subunit protein uL13 Histophilus somni (strain 2336)
B8F3F6 1.55e-92 266 90 0 142 3 rplM Large ribosomal subunit protein uL13 Glaesserella parasuis serovar 5 (strain SH0165)
B0BUF9 1.32e-91 264 89 0 142 3 rplM Large ribosomal subunit protein uL13 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H129 1.32e-91 264 89 0 142 3 rplM Large ribosomal subunit protein uL13 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MZW6 1.32e-91 264 89 0 142 3 rplM Large ribosomal subunit protein uL13 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
P31781 2.78e-91 263 88 0 142 3 rplM Large ribosomal subunit protein uL13 Histophilus somni
A5UC55 1.43e-90 261 88 0 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus influenzae (strain PittEE)
Q4QKH0 1.43e-90 261 88 0 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus influenzae (strain 86-028NP)
P44387 1.56e-90 261 88 0 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UEW0 1.56e-90 261 88 0 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus influenzae (strain PittGG)
Q65T20 3.55e-90 261 88 0 142 3 rplM Large ribosomal subunit protein uL13 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A6VPF5 1.12e-89 259 88 0 142 3 rplM Large ribosomal subunit protein uL13 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
C4K5S0 4.11e-87 253 83 0 142 3 rplM Large ribosomal subunit protein uL13 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q7VLF6 1.54e-84 246 84 1 142 3 rplM Large ribosomal subunit protein uL13 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q6LMD4 1.03e-82 242 78 0 142 3 rplM Large ribosomal subunit protein uL13 Photobacterium profundum (strain SS9)
Q87SI5 1.2e-82 242 79 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VIY3 1.7e-82 241 79 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio atlanticus (strain LGP32)
A1SYL6 2.47e-82 241 79 0 142 3 rplM Large ribosomal subunit protein uL13 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A7MWM9 4.77e-82 240 78 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio campbellii (strain ATCC BAA-1116)
Q07XR8 4.88e-82 240 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella frigidimarina (strain NCIMB 400)
Q7MNX1 3.59e-81 238 78 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio vulnificus (strain YJ016)
Q8DEI9 3.59e-81 238 78 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio vulnificus (strain CMCP6)
Q12RX8 8.54e-81 237 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B5FB55 9.74e-81 237 77 0 142 3 rplM Large ribosomal subunit protein uL13 Aliivibrio fischeri (strain MJ11)
Q5E2M9 9.74e-81 237 77 0 142 3 rplM Large ribosomal subunit protein uL13 Aliivibrio fischeri (strain ATCC 700601 / ES114)
C3LS60 1.25e-80 236 77 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUF1 1.25e-80 236 77 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F997 1.25e-80 236 77 0 142 3 rplM Large ribosomal subunit protein uL13 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C4LCK7 2.22e-80 236 76 0 142 3 rplM Large ribosomal subunit protein uL13 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
B4RXK9 2.34e-80 236 78 0 142 3 rplM Large ribosomal subunit protein uL13 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B6ELJ5 2.73e-80 236 77 0 142 3 rplM Large ribosomal subunit protein uL13 Aliivibrio salmonicida (strain LFI1238)
A1RNJ8 3.15e-80 236 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella sp. (strain W3-18-1)
A4Y3E1 3.15e-80 236 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1SA67 3.51e-80 235 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q0HYX5 3.79e-80 235 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella sp. (strain MR-7)
Q0HF30 3.79e-80 235 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella sp. (strain MR-4)
A0KT11 3.79e-80 235 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella sp. (strain ANA-3)
Q8EAG2 3.79e-80 235 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A4SHZ4 4.05e-80 235 77 0 142 3 rplM Large ribosomal subunit protein uL13 Aeromonas salmonicida (strain A449)
Q5R0K6 4.33e-80 235 77 0 142 3 rplM Large ribosomal subunit protein uL13 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9L111 7.66e-80 234 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella baltica (strain OS195)
A3D8R4 7.66e-80 234 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E9M7 7.66e-80 234 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella baltica (strain OS223)
A6WJ70 1.58e-79 234 78 0 142 3 rplM Large ribosomal subunit protein uL13 Shewanella baltica (strain OS185)
A6VXZ3 2.03e-79 233 77 0 142 3 rplM Large ribosomal subunit protein uL13 Marinomonas sp. (strain MWYL1)
A0KPZ3 2.56e-79 233 77 0 142 3 rplM Large ribosomal subunit protein uL13 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q3IG26 2.67e-79 233 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudoalteromonas translucida (strain TAC 125)
Q3BYA9 5.64e-79 232 76 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q7CLV7 5.64e-79 232 76 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RN05 5.64e-79 232 76 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas campestris pv. campestris (strain B100)
Q4UZF2 5.64e-79 232 76 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas campestris pv. campestris (strain 8004)
Q8NL21 5.64e-79 232 76 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas axonopodis pv. citri (strain 306)
B2FJU4 8.27e-79 232 76 0 142 3 rplM Large ribosomal subunit protein uL13 Stenotrophomonas maltophilia (strain K279a)
Q5GV66 1.27e-78 231 75 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SL09 1.27e-78 231 75 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NYE3 1.27e-78 231 75 0 142 3 rplM Large ribosomal subunit protein uL13 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
C3K6E1 1.37e-77 229 76 0 140 3 rplM Large ribosomal subunit protein uL13 Pseudomonas fluorescens (strain SBW25)
Q4K6H2 3.12e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q9HVY2 3.41e-77 228 76 0 142 1 rplM Large ribosomal subunit protein uL13 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02H07 3.41e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UZL1 3.41e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas aeruginosa (strain LESB58)
A6VBA6 3.97e-77 228 76 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas aeruginosa (strain PA7)
Q3K723 4.48e-77 228 75 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas fluorescens (strain Pf0-1)
B4SLE1 6.03e-77 227 74 0 142 3 rplM Large ribosomal subunit protein uL13 Stenotrophomonas maltophilia (strain R551-3)
Q1QVF0 7.03e-77 227 76 0 142 3 rplM Large ribosomal subunit protein uL13 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0VS24 9.14e-77 227 73 0 142 3 rplM Large ribosomal subunit protein uL13 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1I596 1.33e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas entomophila (strain L48)
Q4ZNX2 1.71e-76 226 75 0 140 3 rplM Large ribosomal subunit protein uL13 Pseudomonas syringae pv. syringae (strain B728a)
Q48EE0 1.71e-76 226 75 0 140 3 rplM Large ribosomal subunit protein uL13 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B1J1W8 2.13e-76 226 73 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas putida (strain W619)
Q88N97 2.48e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KFU8 2.48e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas putida (strain GB-1)
A5W8S1 2.48e-76 226 74 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A4XQQ3 3.52e-76 225 75 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudomonas mendocina (strain ymp)
A4VIF7 3.6e-76 225 74 0 142 3 rplM Large ribosomal subunit protein uL13 Stutzerimonas stutzeri (strain A1501)
B0V669 3.8e-76 225 74 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain AYE)
A3M907 3.8e-76 225 74 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VV43 3.8e-76 225 74 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain SDF)
B2HZ29 3.8e-76 225 74 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain ACICU)
B7I9B0 3.8e-76 225 74 0 142 1 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain AB0057)
B7GWI2 3.8e-76 225 74 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baumannii (strain AB307-0294)
Q0A6F3 4.68e-76 225 73 0 142 3 rplM Large ribosomal subunit protein uL13 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
C1DQ78 5.17e-76 225 73 0 142 3 rplM Large ribosomal subunit protein uL13 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
B5EQH8 9.87e-76 224 71 0 142 3 rplM Large ribosomal subunit protein uL13 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JAI4 9.87e-76 224 71 0 142 3 rplM Large ribosomal subunit protein uL13 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q6F898 1.19e-75 224 73 0 142 3 rplM Large ribosomal subunit protein uL13 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q15PI3 1.43e-75 224 73 0 142 3 rplM Large ribosomal subunit protein uL13 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q87WW7 2.45e-75 223 75 0 140 3 rplM Large ribosomal subunit protein uL13 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q47VT1 3.64e-75 223 72 0 142 3 rplM Large ribosomal subunit protein uL13 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q87DD3 6.37e-75 222 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U6Z6 6.37e-75 222 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xylella fastidiosa (strain M12)
B2IAE8 6.37e-75 222 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xylella fastidiosa (strain M23)
Q2S9X2 9.87e-75 222 72 0 142 3 rplM Large ribosomal subunit protein uL13 Hahella chejuensis (strain KCTC 2396)
Q21FV8 1.56e-74 221 69 0 142 3 rplM Large ribosomal subunit protein uL13 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B8GNH1 2.15e-74 221 69 0 142 3 rplM Large ribosomal subunit protein uL13 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q9PD42 2.51e-74 221 74 0 142 3 rplM Large ribosomal subunit protein uL13 Xylella fastidiosa (strain 9a5c)
B3PBM0 3.12e-74 220 72 0 142 3 rplM Large ribosomal subunit protein uL13 Cellvibrio japonicus (strain Ueda107)
Q60AF8 1.02e-73 219 71 0 142 3 rplM Large ribosomal subunit protein uL13 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
C5BS66 2.08e-73 218 68 0 142 3 rplM Large ribosomal subunit protein uL13 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B8D7S6 3.02e-73 218 68 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57471 3.02e-73 218 68 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9H4 3.02e-73 218 68 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A5EXM0 1.09e-72 216 68 0 142 3 rplM Large ribosomal subunit protein uL13 Dichelobacter nodosus (strain VCS1703A)
A5IAL7 1.18e-72 216 71 0 142 3 rplM Large ribosomal subunit protein uL13 Legionella pneumophila (strain Corby)
Q5X1I1 1.18e-72 216 71 0 142 3 rplM Large ribosomal subunit protein uL13 Legionella pneumophila (strain Paris)
Q5WT90 1.58e-72 216 71 0 142 3 rplM Large ribosomal subunit protein uL13 Legionella pneumophila (strain Lens)
Q5ZS12 1.58e-72 216 71 0 142 3 rplM Large ribosomal subunit protein uL13 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q31IG6 2.8e-72 215 69 0 142 3 rplM Large ribosomal subunit protein uL13 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
C1DDC6 6.3e-72 214 72 0 142 3 rplM Large ribosomal subunit protein uL13 Laribacter hongkongensis (strain HLHK9)
Q5P7T7 7.03e-72 214 71 0 142 3 rplM Large ribosomal subunit protein uL13 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B0TYE8 1.62e-71 213 68 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A1K971 2.17e-71 213 71 0 142 3 rplM Large ribosomal subunit protein uL13 Azoarcus sp. (strain BH72)
A4IX24 2.8e-71 213 67 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BLK8 2.8e-71 213 67 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q7F4 2.8e-71 213 67 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. novicida (strain U112)
B2SGW2 2.8e-71 213 67 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A332 2.8e-71 213 67 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. holarctica (strain LVS)
A7NCM5 4.1e-71 213 66 0 142 3 rplM Large ribosomal subunit protein uL13 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q3J7B4 5.46e-71 212 69 0 142 3 rplM Large ribosomal subunit protein uL13 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q89AE6 5.89e-71 212 64 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A9I237 7.66e-70 209 68 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A1AXJ2 1.63e-69 208 65 0 142 3 rplM Large ribosomal subunit protein uL13 Ruthia magnifica subsp. Calyptogena magnifica
Q1LU54 4.63e-69 207 66 0 142 3 rplM Large ribosomal subunit protein uL13 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q3SLK1 5.1e-69 207 68 0 142 3 rplM Large ribosomal subunit protein uL13 Thiobacillus denitrificans (strain ATCC 25259)
Q493Y6 5.63e-69 207 64 0 142 3 rplM Large ribosomal subunit protein uL13 Blochmanniella pennsylvanica (strain BPEN)
Q8K9F9 1.46e-68 206 64 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q4FRE5 2.34e-68 206 68 0 142 3 rplM Large ribosomal subunit protein uL13 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q7NRT3 2.92e-68 205 68 0 142 3 rplM Large ribosomal subunit protein uL13 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q47IC5 3.92e-68 205 66 0 142 3 rplM Large ribosomal subunit protein uL13 Dechloromonas aromatica (strain RCB)
Q475T3 5.88e-68 204 68 0 142 3 rplM Large ribosomal subunit protein uL13 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1GXB2 6.14e-68 204 69 0 142 3 rplM Large ribosomal subunit protein uL13 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2KV01 6.56e-68 204 66 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella avium (strain 197N)
Q67JX6 7.09e-68 204 66 0 141 3 rplM Large ribosomal subunit protein uL13 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B2AH57 7.09e-68 204 68 0 142 3 rplM Large ribosomal subunit protein uL13 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0KED9 7.09e-68 204 68 0 142 3 rplM Large ribosomal subunit protein uL13 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1Q9X9 7.49e-68 204 66 0 142 3 rplM Large ribosomal subunit protein uL13 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q1LRD0 1.12e-67 204 67 0 142 3 rplM Large ribosomal subunit protein uL13 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q5F5A5 1.15e-67 204 68 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q0AI00 1.38e-67 204 67 0 142 3 rplM Large ribosomal subunit protein uL13 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A5WDK9 1.44e-67 204 67 0 142 3 rplM Large ribosomal subunit protein uL13 Psychrobacter sp. (strain PRwf-1)
A5CVT9 2.19e-67 203 63 0 142 3 rplM Large ribosomal subunit protein uL13 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q7VUV8 3.67e-67 202 66 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W3Z1 3.67e-67 202 66 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WFC3 3.67e-67 202 66 0 142 3 rplM Large ribosomal subunit protein uL13 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A1KWD6 4.05e-67 202 67 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7DD49 4.05e-67 202 67 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JQM8 4.05e-67 202 67 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M087 4.05e-67 202 67 0 142 3 rplM Large ribosomal subunit protein uL13 Neisseria meningitidis serogroup C (strain 053442)
C4ZI85 4.62e-67 202 64 0 142 3 rplM Large ribosomal subunit protein uL13 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q82UK0 5.32e-67 202 68 0 142 3 rplM Large ribosomal subunit protein uL13 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B1Y3K7 5.32e-67 202 66 0 142 3 rplM Large ribosomal subunit protein uL13 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q8Y246 6.93e-67 202 68 0 142 3 rplM Large ribosomal subunit protein uL13 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q124N6 7.32e-67 202 66 0 142 3 rplM Large ribosomal subunit protein uL13 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1W3P7 2.07e-66 201 65 0 142 3 rplM Large ribosomal subunit protein uL13 Acidovorax sp. (strain JS42)
B9MD52 2.07e-66 201 65 0 142 3 rplM Large ribosomal subunit protein uL13 Acidovorax ebreus (strain TPSY)
A1WL74 2.23e-66 201 65 0 142 3 rplM Large ribosomal subunit protein uL13 Verminephrobacter eiseniae (strain EF01-2)
A1WYS9 2.76e-66 200 65 0 142 3 rplM Large ribosomal subunit protein uL13 Halorhodospira halophila (strain DSM 244 / SL1)
Q2YBK2 4.66e-66 200 65 0 142 3 rplM Large ribosomal subunit protein uL13 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A9C179 6.13e-66 199 64 0 142 3 rplM Large ribosomal subunit protein uL13 Delftia acidovorans (strain DSM 14801 / SPH-1)
A1TUF6 6.92e-66 199 64 0 142 3 rplM Large ribosomal subunit protein uL13 Paracidovorax citrulli (strain AAC00-1)
A9KJF5 7.3e-66 199 61 0 142 3 rplM Large ribosomal subunit protein uL13 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B8DPL7 1.03e-65 199 63 0 142 3 rplM Large ribosomal subunit protein uL13 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
B2UFK1 1.03e-65 199 66 0 142 3 rplM Large ribosomal subunit protein uL13 Ralstonia pickettii (strain 12J)
A1VJJ3 1.12e-65 199 64 0 142 3 rplM Large ribosomal subunit protein uL13 Polaromonas naphthalenivorans (strain CJ2)
A4G1T2 2.81e-65 198 66 0 142 3 rplM Large ribosomal subunit protein uL13 Herminiimonas arsenicoxydans
C5CM24 2.84e-65 198 65 0 141 3 rplM Large ribosomal subunit protein uL13 Variovorax paradoxus (strain S110)
Q2SZ69 3.46e-65 197 66 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63QW3 3.46e-65 197 66 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia pseudomallei (strain K96243)
A3NDG8 3.46e-65 197 66 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia pseudomallei (strain 668)
Q3JNR1 3.46e-65 197 66 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia pseudomallei (strain 1710b)
A3NZ80 3.46e-65 197 66 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia pseudomallei (strain 1106a)
A4JBK4 4.81e-65 197 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BZ45 4.81e-65 197 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia orbicola (strain AU 1054)
B1JVU4 4.81e-65 197 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia orbicola (strain MC0-3)
Q39JK0 4.81e-65 197 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BI91 4.81e-65 197 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4EET6 4.81e-65 197 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q13UB2 1.87e-64 196 66 0 142 3 rplM Large ribosomal subunit protein uL13 Paraburkholderia xenovorans (strain LB400)
B2SYL0 1.87e-64 196 66 0 142 3 rplM Large ribosomal subunit protein uL13 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A1V051 3.27e-64 195 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia mallei (strain SAVP1)
Q62HC0 3.27e-64 195 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia mallei (strain ATCC 23344)
A2S581 3.27e-64 195 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia mallei (strain NCTC 10229)
A3MP59 3.27e-64 195 65 0 142 3 rplM Large ribosomal subunit protein uL13 Burkholderia mallei (strain NCTC 10247)
A6SUN7 4.26e-64 195 65 0 142 3 rplM Large ribosomal subunit protein uL13 Janthinobacterium sp. (strain Marseille)
Q220T2 3.85e-63 192 63 0 141 3 rplM Large ribosomal subunit protein uL13 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q30Y43 7.27e-63 192 60 0 142 3 rplM Large ribosomal subunit protein uL13 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B1XS32 2.45e-62 190 62 0 142 3 rplM Large ribosomal subunit protein uL13 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4T034 2.45e-62 190 62 0 142 3 rplM Large ribosomal subunit protein uL13 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A8F9B8 1.54e-61 188 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus pumilus (strain SAFR-032)
Q2LPM2 2.12e-61 188 60 0 142 3 rplM Large ribosomal subunit protein uL13 Syntrophus aciditrophicus (strain SB)
C4KZL3 2.82e-61 188 57 0 140 3 rplM Large ribosomal subunit protein uL13 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
B8I815 4.62e-61 187 60 0 142 3 rplM Large ribosomal subunit protein uL13 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
C5C020 4.71e-61 187 57 0 142 3 rplM Large ribosomal subunit protein uL13 Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q83AX8 5.69e-61 187 56 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NAB1 5.69e-61 187 56 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KBY0 5.69e-61 187 56 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain Dugway 5J108-111)
B6J4G5 5.69e-61 187 56 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain CbuK_Q154)
B6J2V1 8.08e-61 186 55 0 142 3 rplM Large ribosomal subunit protein uL13 Coxiella burnetii (strain CbuG_Q212)
Q057I8 1.8e-60 186 54 0 142 3 rplM Large ribosomal subunit protein uL13 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
C4XNQ2 1.98e-60 186 59 0 142 3 rplM Large ribosomal subunit protein uL13 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
B5YDX6 2.31e-60 185 60 0 142 3 rplM Large ribosomal subunit protein uL13 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B2A4Q6 2.36e-60 185 63 0 136 3 rplM Large ribosomal subunit protein uL13 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
B8E1G6 2.7e-60 185 60 0 142 3 rplM Large ribosomal subunit protein uL13 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q5WLM9 5.85e-60 184 60 0 140 3 rplM Large ribosomal subunit protein uL13 Shouchella clausii (strain KSM-K16)
Q1MQW4 6.12e-60 184 58 0 142 3 rplM Large ribosomal subunit protein uL13 Lawsonia intracellularis (strain PHE/MN1-00)
Q3A3B6 8.15e-60 184 59 0 142 3 rplM Large ribosomal subunit protein uL13 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8IZP2 1.19e-59 184 57 0 142 3 rplM Large ribosomal subunit protein uL13 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
C6C1J9 1.38e-59 183 59 0 142 3 rplM Large ribosomal subunit protein uL13 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A0L480 1.41e-59 183 59 1 143 3 rplM Large ribosomal subunit protein uL13 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1VBD3 1.77e-59 183 57 0 142 3 rplM Large ribosomal subunit protein uL13 Nitratidesulfovibrio vulgaris (strain DP4)
Q728T4 1.77e-59 183 57 0 142 3 rplM Large ribosomal subunit protein uL13 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C0ZIL3 2.09e-59 183 60 0 140 3 rplM Large ribosomal subunit protein uL13 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A9NEI3 2.69e-59 182 57 0 142 3 rplM Large ribosomal subunit protein uL13 Acholeplasma laidlawii (strain PG-8A)
Q2RFT2 3.77e-59 182 60 0 142 3 rplM Large ribosomal subunit protein uL13 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A7GK53 3.81e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A9VPB0 3.85e-59 182 60 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus mycoides (strain KBAB4)
B0K5S7 6.52e-59 182 59 0 142 3 rplM Large ribosomal subunit protein uL13 Thermoanaerobacter sp. (strain X514)
B0KCN4 6.52e-59 182 59 0 142 3 rplM Large ribosomal subunit protein uL13 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q9KGD5 6.66e-59 182 58 0 140 3 rplM Large ribosomal subunit protein uL13 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7NR33 6.87e-59 182 58 0 141 3 rplM Large ribosomal subunit protein uL13 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A0ALT3 7.68e-59 182 55 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Y458 7.68e-59 182 55 0 140 1 rplM Large ribosomal subunit protein uL13 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DB43 7.68e-59 182 55 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria monocytogenes serotype 4a (strain HCC23)
Q71WI1 7.68e-59 182 55 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria monocytogenes serotype 4b (strain F2365)
C1KZ12 7.68e-59 182 55 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria monocytogenes serotype 4b (strain CLIP80459)
A7Z0S1 1.02e-58 181 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q65P73 1.1e-58 181 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3MF94 1.12e-58 181 61 0 141 3 rplM Large ribosomal subunit protein uL13 Trichormus variabilis (strain ATCC 29413 / PCC 7937)
B1YH84 1.4e-58 181 56 0 140 3 rplM Large ribosomal subunit protein uL13 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B8G6P5 1.4e-58 181 56 0 138 3 rplM Large ribosomal subunit protein uL13 Chloroflexus aggregans (strain MD-66 / DSM 9485)
C4Z2W3 1.44e-58 181 59 0 140 3 rplM Large ribosomal subunit protein uL13 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q8ETV4 2.27e-58 180 58 0 140 3 rplM Large ribosomal subunit protein uL13 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q927P2 3.92e-58 180 54 0 140 3 rplM Large ribosomal subunit protein uL13 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
B9LJG2 4.1e-58 180 57 0 138 3 rplM Large ribosomal subunit protein uL13 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH96 4.1e-58 180 57 0 138 3 rplM Large ribosomal subunit protein uL13 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q6ANL8 4.16e-58 179 57 0 142 3 rplM Large ribosomal subunit protein uL13 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
P70974 4.62e-58 179 57 0 140 1 rplM Large ribosomal subunit protein uL13 Bacillus subtilis (strain 168)
Q8YPK6 5.92e-58 179 60 0 141 3 rplM Large ribosomal subunit protein uL13 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q5L3Q6 1.01e-57 179 60 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacillus kaustophilus (strain HTA426)
A8MLH5 1.54e-57 178 58 0 142 3 rplM Large ribosomal subunit protein uL13 Alkaliphilus oremlandii (strain OhILAs)
A5USF9 1.7e-57 178 56 0 141 3 rplM Large ribosomal subunit protein uL13 Roseiflexus sp. (strain RS-1)
B7IT52 1.94e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain G9842)
B1XJI1 2.06e-57 178 61 0 142 3 rplM Large ribosomal subunit protein uL13 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
Q6HPM6 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81J13 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IZM7 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain Q1)
B7HQX7 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain AH187)
B7HJJ0 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain B4264)
C1ET72 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain 03BB102)
Q73F63 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JKF3 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain AH820)
Q81VP9 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus anthracis
A0R8L2 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus thuringiensis (strain Al Hakam)
C3LJX7 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAK3 2.26e-57 178 58 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus anthracis (strain A0248)
Q890R6 2.26e-57 178 57 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium tetani (strain Massachusetts / E88)
A4XBI7 2.39e-57 178 56 0 142 3 rplM Large ribosomal subunit protein uL13 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8M4C0 2.39e-57 178 56 0 142 3 rplM Large ribosomal subunit protein uL13 Salinispora arenicola (strain CNS-205)
A6TWE7 4.42e-57 177 58 0 142 3 rplM Large ribosomal subunit protein uL13 Alkaliphilus metalliredigens (strain QYMF)
Q6H001 5.11e-57 177 58 0 141 3 rplM Large ribosomal subunit protein uL13 Microchaete diplosiphon
A4IJM0 6.33e-57 177 59 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacillus thermodenitrificans (strain NG80-2)
B1LBJ2 7.51e-57 177 58 0 141 3 rplM Large ribosomal subunit protein uL13 Thermotoga sp. (strain RQ2)
A5IMD1 7.51e-57 177 58 0 141 3 rplM Large ribosomal subunit protein uL13 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1G5 7.51e-57 177 58 0 141 3 rplM Large ribosomal subunit protein uL13 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q2IWN7 8.07e-57 177 58 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain HaA2)
Q5N0T9 1.27e-56 176 59 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31L33 1.27e-56 176 59 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q136Q3 1.51e-56 176 58 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain BisB5)
B3EA22 2.05e-56 175 57 0 142 3 rplM Large ribosomal subunit protein uL13 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q7V9Y8 2.22e-56 176 56 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A2BYR0 2.49e-56 175 59 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9515)
Q92QR4 2.72e-56 176 59 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium meliloti (strain 1021)
Q8R7Y8 2.81e-56 175 57 0 142 3 rplM Large ribosomal subunit protein uL13 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A6U7T7 3e-56 175 59 1 143 3 rplM Large ribosomal subunit protein uL13 Sinorhizobium medicae (strain WSM419)
Q2S6I8 3.72e-56 175 58 0 141 3 rplM Large ribosomal subunit protein uL13 Salinibacter ruber (strain DSM 13855 / M31)
Q53874 3.76e-56 175 54 0 142 3 rplM Large ribosomal subunit protein uL13 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A4FPH1 3.8e-56 175 57 0 142 3 rplM Large ribosomal subunit protein uL13 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q6G3I6 4.91e-56 175 56 1 143 3 rplM Large ribosomal subunit protein uL13 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
C5D3V0 5.07e-56 174 57 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacillus sp. (strain WCH70)
B4SEC9 5.45e-56 174 56 0 137 3 rplM Large ribosomal subunit protein uL13 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q7U4H5 6.56e-56 174 56 0 141 3 rplM Large ribosomal subunit protein uL13 Parasynechococcus marenigrum (strain WH8102)
O67722 6.6e-56 174 59 0 142 3 rplM Large ribosomal subunit protein uL13 Aquifex aeolicus (strain VF5)
B9JD18 7.36e-56 174 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q1MIP2 7.61e-56 174 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B3QKG3 9.16e-56 174 56 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain TIE-1)
Q6N651 9.16e-56 174 56 1 143 1 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8UFZ7 9.16e-56 174 58 1 143 3 rplM Large ribosomal subunit protein uL13 Agrobacterium fabrum (strain C58 / ATCC 33970)
A2BTB2 9.79e-56 174 59 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain AS9601)
A9IVX4 9.89e-56 174 56 1 143 3 rplM Large ribosomal subunit protein uL13 Bartonella tribocorum (strain CIP 105476 / IBS 506)
B3PVW4 1.01e-55 174 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium etli (strain CIAT 652)
A8G736 1.03e-55 174 58 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9215)
A8I7Z7 1.12e-55 174 58 1 143 3 rplM Large ribosomal subunit protein uL13 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B7KI14 1.16e-55 174 57 0 141 3 rplM Large ribosomal subunit protein uL13 Gloeothece citriformis (strain PCC 7424)
A6W5X0 1.28e-55 174 55 0 142 3 rplM Large ribosomal subunit protein uL13 Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
C3MA33 1.44e-55 174 58 1 143 3 rplM Large ribosomal subunit protein uL13 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7UZW8 1.67e-55 173 57 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q214E1 1.85e-55 173 55 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodopseudomonas palustris (strain BisB18)
A1UT83 1.93e-55 173 57 1 143 3 rplM Large ribosomal subunit protein uL13 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q00990 1.97e-55 173 54 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus carnosus (strain TM300)
Q3B5U2 1.98e-55 173 54 0 142 3 rplM Large ribosomal subunit protein uL13 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B7K221 2e-55 173 56 0 139 3 rplM Large ribosomal subunit protein uL13 Rippkaea orientalis (strain PCC 8801 / RF-1)
A3PF22 2.2e-55 173 58 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9301)
Q63H58 2.4e-55 173 57 0 140 3 rplM Large ribosomal subunit protein uL13 Bacillus cereus (strain ZK / E33L)
B5ZXZ6 3.48e-55 172 56 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B1W3X5 3.83e-55 172 52 0 142 3 rplM Large ribosomal subunit protein uL13 Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
Q318L0 3.98e-55 172 57 0 140 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9312)
Q748X4 4.34e-55 172 60 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q47LM5 4.36e-55 172 56 0 142 3 rplM Large ribosomal subunit protein uL13 Thermobifida fusca (strain YX)
Q2K9W3 4.58e-55 172 57 1 143 3 rplM Large ribosomal subunit protein uL13 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8DMK8 4.69e-55 172 64 0 128 3 rplM Large ribosomal subunit protein uL13 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q7V521 4.91e-55 172 54 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9313)
A2CC54 4.91e-55 172 54 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain MIT 9303)
Q46IT5 4.97e-55 172 54 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain NATL2A)
A2C4X4 4.97e-55 172 54 0 141 3 rplM Large ribosomal subunit protein uL13 Prochlorococcus marinus (strain NATL1A)
Q0ID31 5.66e-55 172 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain CC9311)
P60488 6.82e-55 171 54 1 142 1 rplM Large ribosomal subunit protein uL13 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q72IN1 6.82e-55 171 54 1 142 1 rplM Large ribosomal subunit protein uL13 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q82DL9 7.15e-55 172 52 0 142 3 rplM Large ribosomal subunit protein uL13 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q6FZQ6 7.25e-55 172 56 1 143 3 rplM Large ribosomal subunit protein uL13 Bartonella quintana (strain Toulouse)
A1ATL1 8.66e-55 171 56 0 142 3 rplM Large ribosomal subunit protein uL13 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B6JGT5 9.63e-55 171 55 1 143 3 rplM Large ribosomal subunit protein uL13 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A5GIR9 9.68e-55 171 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain WH7803)
B9JVC5 9.74e-55 171 58 1 143 3 rplM Large ribosomal subunit protein uL13 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A5GVY6 1.19e-54 171 58 0 137 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain RCC307)
B9E9M3 1.2e-54 171 52 0 141 3 rplM Large ribosomal subunit protein uL13 Macrococcus caseolyticus (strain JCSC5402)
Q982W8 1.27e-54 171 57 1 143 3 rplM Large ribosomal subunit protein uL13 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
C1A3Z5 1.35e-54 171 58 1 141 3 rplM Large ribosomal subunit protein uL13 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
B0JY35 1.45e-54 171 58 0 141 3 rplM Large ribosomal subunit protein uL13 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q3AW67 1.65e-54 171 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain CC9902)
P73294 1.82e-54 171 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0AUL5 1.96e-54 170 52 0 142 3 rplM Large ribosomal subunit protein uL13 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
B6IMQ3 2.07e-54 171 55 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodospirillum centenum (strain ATCC 51521 / SW)
A6X1V4 2.07e-54 171 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B8HMT1 2.13e-54 171 58 0 141 3 rplM Large ribosomal subunit protein uL13 Cyanothece sp. (strain PCC 7425 / ATCC 29141)
A4J152 2.17e-54 170 55 0 140 3 rplM Large ribosomal subunit protein uL13 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q39Y25 2.29e-54 170 58 0 140 3 rplM Large ribosomal subunit protein uL13 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A9BHB6 2.37e-54 171 50 0 140 3 rplM Large ribosomal subunit protein uL13 Petrotoga mobilis (strain DSM 10674 / SJ95)
Q11J65 2.55e-54 171 55 1 143 3 rplM Large ribosomal subunit protein uL13 Chelativorans sp. (strain BNC1)
C1F3Z9 2.82e-54 170 54 0 142 3 rplM Large ribosomal subunit protein uL13 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B8FW04 2.98e-54 170 57 0 142 3 rplM Large ribosomal subunit protein uL13 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B2GDT7 3.31e-54 170 57 0 140 3 rplM Large ribosomal subunit protein uL13 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B3EMI6 3.33e-54 170 56 0 137 3 rplM Large ribosomal subunit protein uL13 Chlorobium phaeobacteroides (strain BS1)
B4S432 3.89e-54 170 52 0 142 3 rplM Large ribosomal subunit protein uL13 Prosthecochloris aestuarii (strain DSM 271 / SK 413)
C6E4S8 4.23e-54 169 55 0 142 3 rplM Large ribosomal subunit protein uL13 Geobacter sp. (strain M21)
Q7A089 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain MW2)
A8Z325 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G7A3 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain MSSA476)
Q6GEL7 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain MRSA252)
Q7A473 4.36e-54 169 56 0 141 1 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain N315)
Q99S51 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QJ60 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain Newman)
Q5HDZ0 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain COL)
Q2YYM8 4.36e-54 169 56 0 141 1 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV02 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain JH9)
Q2FW38 4.36e-54 169 56 0 141 1 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FES1 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain USA300)
A6U3U3 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain JH1)
A7X5B4 4.36e-54 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B8IUE9 4.66e-54 170 56 1 143 3 rplM Large ribosomal subunit protein uL13 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q2JUJ8 7.01e-54 169 60 0 140 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain JA-3-3Ab)
A9B440 7.14e-54 169 52 0 142 3 rplM Large ribosomal subunit protein uL13 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q73PE7 8.82e-54 169 53 0 142 3 rplM Large ribosomal subunit protein uL13 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B1WQT8 1.12e-53 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Crocosphaera subtropica (strain ATCC 51142 / BH68)
Q24ZM6 1.13e-53 168 56 0 142 3 rplM Large ribosomal subunit protein uL13 Desulfitobacterium hafniense (strain Y51)
Q8G1C8 1.14e-53 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella suis biovar 1 (strain 1330)
B0CLB8 1.14e-53 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VPX5 1.14e-53 169 55 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q3AMQ6 1.31e-53 169 56 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain CC9605)
B0UQW6 1.68e-53 168 55 1 143 3 rplM Large ribosomal subunit protein uL13 Methylobacterium sp. (strain 4-46)
B5EFM9 1.76e-53 168 54 0 142 3 rplM Large ribosomal subunit protein uL13 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B0TC91 2.09e-53 168 55 0 142 3 rplM Large ribosomal subunit protein uL13 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
C1D166 2.36e-53 167 57 1 142 3 rplM Large ribosomal subunit protein uL13 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
B2GJ23 2.98e-53 167 55 0 138 3 rplM Large ribosomal subunit protein uL13 Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201)
Q2JL71 3.28e-53 167 58 0 141 3 rplM Large ribosomal subunit protein uL13 Synechococcus sp. (strain JA-2-3B'a(2-13))
B9MLF7 3.62e-53 167 57 0 142 3 rplM Large ribosomal subunit protein uL13 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q3AQ23 5.03e-53 167 54 0 142 3 rplM Large ribosomal subunit protein uL13 Chlorobium chlorochromatii (strain CaD3)
A4XJ59 5.13e-53 167 57 0 142 3 rplM Large ribosomal subunit protein uL13 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q4L881 5.71e-53 167 52 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus haemolyticus (strain JCSC1435)
A0LIV4 5.98e-53 167 55 0 137 3 rplM Large ribosomal subunit protein uL13 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q03PY9 8.53e-53 166 55 0 140 3 rplM Large ribosomal subunit protein uL13 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B1ZCB3 8.74e-53 166 57 1 143 3 rplM Large ribosomal subunit protein uL13 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A1BHZ7 9.92e-53 166 52 0 137 3 rplM Large ribosomal subunit protein uL13 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B0C427 1e-52 166 56 0 141 3 rplM Large ribosomal subunit protein uL13 Acaryochloris marina (strain MBIC 11017)
A9MAG8 1.06e-52 166 54 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q2W1B4 1.28e-52 166 55 1 143 3 rplM Large ribosomal subunit protein uL13 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B2TIL0 1.45e-52 166 53 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium botulinum (strain Eklund 17B / Type B)
B2UYE5 1.45e-52 166 53 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium botulinum (strain Alaska E43 / Type E3)
Q8YGJ1 1.46e-52 166 54 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57DW1 1.46e-52 166 54 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella abortus biovar 1 (strain 9-941)
Q2YND8 1.46e-52 166 54 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella abortus (strain 2308)
B2S536 1.46e-52 166 54 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella abortus (strain S19)
Q2RSE3 1.48e-52 166 54 1 143 3 rplM Large ribosomal subunit protein uL13 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q8KBK4 1.6e-52 166 51 0 142 3 rplM Large ribosomal subunit protein uL13 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A5D5F6 1.69e-52 166 57 1 139 3 rplM Large ribosomal subunit protein uL13 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
Q49ZD6 1.7e-52 166 53 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q89KE4 2.14e-52 166 53 1 143 3 rplM Large ribosomal subunit protein uL13 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8D361 2.43e-52 165 52 0 140 3 rplM Large ribosomal subunit protein uL13 Wigglesworthia glossinidia brevipalpis
B2G8U6 2.52e-52 165 55 0 140 3 rplM Large ribosomal subunit protein uL13 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VLH3 2.52e-52 165 55 0 140 3 rplM Large ribosomal subunit protein uL13 Limosilactobacillus reuteri (strain DSM 20016)
Q74L58 3e-52 165 53 0 140 3 rplM Large ribosomal subunit protein uL13 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
A8LKY0 3.11e-52 165 56 2 143 3 rplM Large ribosomal subunit protein uL13 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q38UV4 3.54e-52 165 56 0 140 3 rplM Large ribosomal subunit protein uL13 Latilactobacillus sakei subsp. sakei (strain 23K)
A5N4T1 3.67e-52 165 53 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYE3 3.67e-52 165 53 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium kluyveri (strain NBRC 12016)
A6Q5F7 4.03e-52 164 57 1 133 3 rplM Large ribosomal subunit protein uL13 Nitratiruptor sp. (strain SB155-2)
B1M200 4.09e-52 165 57 1 143 3 rplM Large ribosomal subunit protein uL13 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Q9RXY1 4.66e-52 166 55 1 143 1 rplM Large ribosomal subunit protein uL13 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B1KSJ0 4.72e-52 164 54 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium botulinum (strain Loch Maree / Type A3)
A7FZ38 4.72e-52 164 54 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium botulinum (strain ATCC 19397 / Type A)
A0PXY1 5.33e-52 164 53 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium novyi (strain NT)
Q1WSC2 7.05e-52 164 55 0 140 3 rplM Large ribosomal subunit protein uL13 Ligilactobacillus salivarius (strain UCC118)
C0RIC6 7.05e-52 164 53 1 143 3 rplM Large ribosomal subunit protein uL13 Brucella melitensis biotype 2 (strain ATCC 23457)
C0R579 8.61e-52 164 53 1 143 3 rplM Large ribosomal subunit protein uL13 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
B1MG81 1.06e-51 164 53 0 142 3 rplM Large ribosomal subunit protein uL13 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
Q5HM31 1.13e-51 163 51 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B2URH4 1.23e-51 163 54 0 142 3 rplM Large ribosomal subunit protein uL13 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
P51292 1.45e-51 163 55 0 126 3 rpl13 Large ribosomal subunit protein uL13c Porphyra purpurea
Q0API1 1.66e-51 163 55 2 144 3 rplM Large ribosomal subunit protein uL13 Maricaulis maris (strain MCS10)
A4SDB9 1.72e-51 163 54 0 137 3 rplM Large ribosomal subunit protein uL13 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
B3EFY2 1.72e-51 163 52 0 142 3 rplM Large ribosomal subunit protein uL13 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q2JFE4 1.97e-51 163 52 0 142 3 rplM Large ribosomal subunit protein uL13 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
B3QLF5 2.21e-51 163 54 0 137 3 rplM Large ribosomal subunit protein uL13 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q73IT2 2.38e-51 163 52 1 143 3 rplM Large ribosomal subunit protein uL13 Wolbachia pipientis wMel
Q3A9V1 2.47e-51 162 52 0 140 3 rplM Large ribosomal subunit protein uL13 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q03EE8 2.68e-51 162 56 0 140 3 rplM Large ribosomal subunit protein uL13 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q0SQH8 5.3e-51 162 52 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium perfringens (strain SM101 / Type A)
Q8XHV6 5.3e-51 162 52 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium perfringens (strain 13 / Type A)
Q0S3D9 6.01e-51 162 52 0 142 3 rplM Large ribosomal subunit protein uL13 Rhodococcus jostii (strain RHA1)
A0QSP8 6.86e-51 161 52 0 142 1 rplM Large ribosomal subunit protein uL13 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A4YVP3 7.73e-51 162 53 1 143 3 rplM Large ribosomal subunit protein uL13 Bradyrhizobium sp. (strain ORS 278)
A5EKC7 7.73e-51 162 53 1 143 3 rplM Large ribosomal subunit protein uL13 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8CRI9 7.84e-51 161 51 0 141 3 rplM Large ribosomal subunit protein uL13 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q97EL2 8.03e-51 161 52 0 142 3 rplM Large ribosomal subunit protein uL13 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5Z1I0 8.08e-51 161 53 0 142 3 rplM Large ribosomal subunit protein uL13 Nocardia farcinica (strain IFM 10152)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_07730
Feature type CDS
Gene rplM
Product 50S ribosomal protein L13
Location 218347 - 218775 (strand: 1)
Length 429 (nucleotides) / 142 (amino acids)
In genomic island -

Contig

Accession ZDB_522
Length 269640 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_789
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00572 Ribosomal protein L13

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0102 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L13

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02871 large subunit ribosomal protein L13 Ribosome -

Protein Sequence

MKTFTAKPESVQRDWFVVDATGKTLGRLATELARRLRGKHKAEYTPHVDTGDYIIVLNAEKVAVTGNKRTDKVYYRHTGYVGGIKQATFEEMIARHPERVIEIAVKGMLPKGPLGRAMYRKLKVYAGNEHNHAAQQPQVLDI

Flanking regions ( +/- flanking 50bp)

TTCTGAACATTGGTTCACCAACATGTAACTTATTTATTGGGTAAGCTTTAATGAAAACTTTTACAGCTAAACCAGAAAGCGTACAACGCGACTGGTTCGTTGTTGATGCAACCGGCAAAACTTTAGGCCGCCTTGCAACTGAATTAGCCCGCCGTCTGCGCGGTAAGCACAAAGCGGAATATACTCCTCACGTTGACACCGGTGATTACATCATCGTTCTGAACGCAGAAAAAGTTGCTGTAACCGGCAATAAGCGTACAGACAAAGTGTACTATCGCCACACTGGCTACGTTGGTGGTATTAAGCAAGCGACCTTCGAAGAGATGATCGCACGCCATCCTGAGCGCGTTATTGAAATCGCTGTGAAAGGCATGTTGCCGAAAGGCCCTCTGGGTCGTGCAATGTACCGTAAACTGAAAGTTTACGCAGGTAACGAGCACAATCACGCGGCACAGCAACCGCAAGTTCTGGACATTTAATCGGGATTATAGGCAATGGCTGAAAATCAATACTACGGCACTGGTCGCCG