Homologs in group_737

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03260 FBDBKF_03260 72.9 Morganella morganii S1 ptsN PTS IIA-like nitrogen regulatory protein PtsN
EHELCC_07275 EHELCC_07275 72.9 Morganella morganii S2 ptsN PTS IIA-like nitrogen regulatory protein PtsN
NLDBIP_07600 NLDBIP_07600 72.9 Morganella morganii S4 ptsN PTS IIA-like nitrogen regulatory protein PtsN
LHKJJB_07135 LHKJJB_07135 72.9 Morganella morganii S3 ptsN PTS IIA-like nitrogen regulatory protein PtsN
HKOGLL_03795 HKOGLL_03795 72.9 Morganella morganii S5 ptsN PTS IIA-like nitrogen regulatory protein PtsN
F4V73_RS11660 F4V73_RS11660 73.5 Morganella psychrotolerans ptsN PTS IIA-like nitrogen regulatory protein PtsN

Distribution of the homologs in the orthogroup group_737

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_737

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P69815 3.52e-76 227 70 1 154 3 ptsN Nitrogen regulatory protein Shigella flexneri
P69829 3.52e-76 227 70 1 154 1 ptsN Nitrogen regulatory protein Escherichia coli (strain K12)
P17162 7.17e-75 223 69 1 155 3 ptsN Nitrogen regulatory protein Klebsiella oxytoca
P45072 1.03e-33 119 37 1 149 4 ptsN Nitrogen regulatory protein homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P30335 1.13e-32 116 37 1 148 3 ptsN Nitrogen regulatory protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q9HVV4 3.33e-31 112 44 3 152 3 ptsN Nitrogen regulatory protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
D4GYE4 4.22e-17 76 36 1 106 2 ptfA PTS system fructose-specific EIIA component Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O31645 8.04e-13 68 32 2 125 1 manP PTS system mannose-specific EIIBCA component Bacillus subtilis (strain 168)
P54745 2.58e-12 66 29 5 152 1 mngA PTS system 2-O-alpha-mannosyl-D-glycerate-specific EIIABC component Escherichia coli (strain K12)
P33670 6.05e-11 58 41 2 89 3 ptsN Nitrogen regulatory protein (Fragment) Pseudomonas putida
P71012 7.14e-10 59 26 2 150 1 fruA PTS system fructose-specific EIIABC component Bacillus subtilis (strain 168)
Q8K911 6.03e-08 53 28 4 131 3 mtlA PTS system mannitol-specific EIICBA component Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P32155 2.15e-07 50 24 2 138 3 frvA PTS system fructose-like EIIA component Escherichia coli (strain K12)
Q6GER9 1.04e-06 48 28 3 136 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain MRSA252)
P0A0D9 1.47e-06 48 28 3 136 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain MW2)
Q6G7F4 1.47e-06 48 28 3 136 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain MSSA476)
P0A0D8 1.47e-06 48 28 3 136 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain N315)
P0A0D7 1.47e-06 48 28 3 136 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HE46 1.47e-06 48 28 3 136 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Staphylococcus aureus (strain COL)
Q9XBM7 3.28e-06 48 27 2 106 3 mtlA PTS system mannitol-specific EIICBA component Klebsiella pneumoniae
P57635 4.44e-06 48 25 4 136 3 mtlA PTS system mannitol-specific EIICBA component Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P69811 8.1e-06 47 26 4 142 1 fruB Multiphosphoryl transfer protein Escherichia coli (strain K12)
P69812 8.1e-06 47 26 4 142 3 fruB Multiphosphoryl transfer protein Escherichia coli O157:H7
P00550 1.33e-05 47 26 2 104 1 mtlA PTS system mannitol-specific EIICBA component Escherichia coli (strain K12)
P77439 2.33e-05 46 27 2 103 1 fryA Multiphosphoryl transfer protein 1 Escherichia coli (strain K12)
P17127 3.52e-05 45 26 3 141 1 fruB Multiphosphoryl transfer protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z591 4.3e-05 45 26 3 141 3 fruB Multiphosphoryl transfer protein Salmonella typhi
P75039 5.48e-05 45 30 2 108 3 fruA PTS system fructose-specific EIIABC component Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q9KM70 7.19e-05 45 27 4 132 2 fruB Multiphosphoryl transfer protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q83QP3 7.6e-05 45 26 2 103 3 fryA Multiphosphoryl transfer protein Shigella flexneri
Q8XBQ8 8.04e-05 45 26 2 103 3 fryA Multiphosphoryl transfer protein Escherichia coli O157:H7
Q8FFD8 0.000189 43 26 2 103 3 fryA Multiphosphoryl transfer protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P47308 0.000205 43 29 2 114 3 fruA PTS system fructose-specific EIIABC component Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9CLY8 0.000351 43 26 2 104 3 mtlA PTS system mannitol-specific EIICBA component Pasteurella multocida (strain Pm70)
Q89A36 0.000398 43 27 4 128 3 mtlA PTS system mannitol-specific EIICBA component Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8FAJ0 0.000409 42 30 3 91 3 ulaC Ascorbate-specific PTS system EIIA component Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69820 0.000422 42 30 3 91 1 ulaC Ascorbate-specific PTS system EIIA component Escherichia coli (strain K12)
P69821 0.000422 42 30 3 91 3 ulaC Ascorbate-specific PTS system EIIA component Escherichia coli O157:H7
Q9K680 0.000464 41 31 3 104 3 mtlF Mannitol-specific phosphotransferase enzyme IIA component Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P44715 0.000573 42 26 3 123 3 fruB Multiphosphoryl transfer protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q3YUF3 0.000783 41 26 2 90 3 ulaC Ascorbate-specific PTS system EIIA component Shigella sonnei (strain Ss046)
Q83P28 0.000783 41 26 2 90 3 ulaC Ascorbate-specific PTS system EIIA component Shigella flexneri
Q31TC6 0.000783 41 26 2 90 3 ulaC Ascorbate-specific PTS system EIIA component Shigella boydii serotype 4 (strain Sb227)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18140
Feature type CDS
Gene ptsN
Product PTS IIA-like nitrogen regulatory protein PtsN
Location 3984352 - 3984819 (strand: -1)
Length 468 (nucleotides) / 155 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_737
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00359 Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1762 Carbohydrate transport and metabolism (G)
Signal transduction mechanisms (T)		 GT Phosphotransferase system mannitol/fructose-specific IIA domain (Ntr-type)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02806 nitrogen PTS system EIIA component [EC:2.7.1.-] Phosphotransferase system (PTS) -

Protein Sequence

MNNDTKMNISDVLTLACTHNNVHCTSKKRALEIISENAAQALNLPETLIFEALLTREKVGTTGIGGGLAIPHGRIESDETEKVVGVFLHLSEPIAFDAIDNQPVDLLFALLVPATQCKEHLHTLSLIAKQLADKNLCRRLRSAQSDEELYQIITE

Flanking regions ( +/- flanking 50bp)

CCAGATGTCACTCTGTGGCATCTGGTTTGCTGGTCTAAGTGAATAAGACAATGAACAACGATACAAAGATGAATATTAGCGACGTACTTACTCTGGCATGTACACATAACAATGTGCATTGCACAAGTAAAAAACGCGCGTTAGAAATTATCAGTGAGAATGCAGCTCAAGCACTGAATTTACCAGAAACACTGATTTTTGAGGCTTTATTAACGCGTGAAAAAGTCGGTACAACAGGGATAGGGGGTGGATTGGCTATCCCTCATGGGCGTATTGAAAGTGATGAAACTGAAAAAGTTGTTGGTGTGTTTCTTCACCTAAGCGAGCCTATTGCCTTCGACGCTATTGATAATCAACCTGTCGATTTGTTGTTTGCATTACTCGTTCCTGCAACACAATGTAAGGAACATTTACACACACTGTCTTTGATTGCAAAACAGTTGGCTGACAAAAATTTATGTCGCCGACTACGCTCCGCACAAAGTGATGAAGAGCTTTATCAGATTATCACAGAATAAACCTAATGGGTTTGGGTTTATCAGGACGCGAATAGCATACAGTGGAATGA