Homologs in group_751

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_03345 FBDBKF_03345 71.9 Morganella morganii S1 mreC rod shape-determining protein MreC
EHELCC_07190 EHELCC_07190 71.9 Morganella morganii S2 mreC rod shape-determining protein MreC
NLDBIP_07515 NLDBIP_07515 71.9 Morganella morganii S4 mreC rod shape-determining protein MreC
LHKJJB_07050 LHKJJB_07050 71.9 Morganella morganii S3 mreC rod shape-determining protein MreC
HKOGLL_03880 HKOGLL_03880 71.9 Morganella morganii S5 mreC rod shape-determining protein MreC
F4V73_RS11590 F4V73_RS11590 73.0 Morganella psychrotolerans mreC rod shape-determining protein MreC

Distribution of the homologs in the orthogroup group_751

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_751

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P16926 7.38e-145 416 68 1 327 1 mreC Cell shape-determining protein MreC Escherichia coli (strain K12)
P44475 1.68e-98 298 45 3 344 3 mreC Cell shape-determining protein MreC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B8H610 4.24e-21 95 31 8 256 1 mreC Cell shape-determining protein MreC Caulobacter vibrioides (strain NA1000 / CB15N)
Q70AN6 1.11e-19 91 32 5 230 3 mreC Cell shape-determining protein MreC Cereibacter sphaeroides
Q8Y6Y4 1.39e-16 82 28 3 205 1 mreC Cell shape-determining protein MreC Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8DMY2 4.47e-12 68 27 4 225 1 mreC Cell shape-determining protein MreC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P84480 9.01e-12 68 25 6 239 3 mreC Cell shape-determining protein MreC Geobacillus stearothermophilus
Q01466 9.01e-12 68 25 6 239 1 mreC Cell shape-determining protein MreC Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS18070
Feature type CDS
Gene mreC
Product rod shape-determining protein MreC
Location 3969614 - 3970660 (strand: 1)
Length 1047 (nucleotides) / 348 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_751
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04085 rod shape-determining protein MreC

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1792 Cell cycle control, cell division, chromosome partitioning (D)
Cytoskeleton (Z)		 DZ Cell shape-determining protein MreC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03570 rod shape-determining protein MreC - -

Protein Sequence

MKPIFSRGPSLQLRLIIAVIIAISLLIADNRIGAFSKVRQYLDTAVSPFYFLANGPRRFLDQLSETFATRERLQFENQALRKELLVRSGESQLLEQFKQENARLRELLGSPLRQNEQMTVTQVLSGNSTPYRDQVVIDKGTNDGVYEGQPVISDKGVVGQVIAVSELTSRVLLICDTSHALPVQVLRNDIRVIASGAGCADDLLLEALPANIDIRVGDVLVTSGLGGRFPEGYPVGVVSSVKVDNQRAYSVINVRPSAELQRLRYLLLLWNASEKKQAPPLPSEVYRAANERLMQLMPQVLPNYEQAGPPLPRSMSQEPTENSATPSDIAPVPPTENNKPQPNTNRGR

Flanking regions ( +/- flanking 50bp)

AATATTAACACCTGTTCTTTTACTTCTCCGTGTGAGTGATCTTAGAGTTTATGAAGCCTATTTTTAGTCGGGGGCCTTCCCTGCAACTAAGATTAATAATCGCTGTGATTATCGCGATATCGTTGTTAATTGCTGATAATCGCATAGGTGCTTTTTCAAAAGTCCGTCAGTATTTGGATACTGCTGTGAGTCCTTTCTATTTTCTTGCAAATGGGCCTCGTCGTTTCCTTGATCAACTCTCTGAAACCTTTGCAACTCGCGAACGTTTACAATTTGAAAATCAAGCGCTAAGAAAAGAGCTTCTTGTTCGCAGTGGTGAAAGTCAGCTACTGGAACAATTTAAACAAGAAAATGCCCGCTTACGAGAATTACTTGGTTCACCTTTACGTCAAAATGAACAAATGACGGTAACACAAGTGTTGTCTGGTAATAGTACGCCTTATCGAGATCAAGTGGTGATAGACAAAGGCACTAATGATGGGGTGTATGAAGGTCAGCCTGTTATTAGTGATAAAGGCGTTGTTGGACAAGTTATTGCCGTAAGTGAGTTAACCAGCCGAGTACTGTTAATTTGTGATACCTCTCATGCATTACCGGTACAAGTATTACGTAATGATATTCGCGTTATTGCCTCAGGGGCTGGGTGTGCGGATGATCTACTGTTAGAGGCACTACCTGCGAATATCGATATTCGTGTAGGGGATGTGTTAGTCACCTCAGGATTAGGGGGACGCTTTCCTGAAGGTTATCCTGTTGGGGTTGTTTCTTCGGTAAAAGTCGATAATCAACGTGCTTATTCGGTGATTAATGTGCGACCTTCTGCTGAATTACAACGTTTACGTTATCTGTTGCTATTATGGAACGCCTCAGAGAAGAAACAAGCGCCACCGTTACCCTCAGAGGTTTACCGTGCTGCCAATGAACGTTTGATGCAATTAATGCCACAGGTACTGCCTAACTATGAACAAGCGGGGCCACCACTGCCTCGTTCTATGTCACAAGAGCCAACGGAAAATAGCGCCACCCCAAGTGATATAGCACCAGTACCACCAACGGAAAACAATAAACCTCAACCTAATACGAATCGAGGTAGATAGTGACAATCAATCCTTATCGTAGCCGTGGGCGTTGGATTATTTGGCTCTCG