Homologs in group_3912

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
PMI_RS17990 PMI_RS17990 30.3 Proteus mirabilis HI4320 ugpE sn-glycerol-3-phosphate ABC transporter permease UgpE

Distribution of the homologs in the orthogroup group_3912

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3912

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q92WD8 1.6e-120 350 59 0 291 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Rhizobium meliloti (strain 1021)
Q8FW09 1.85e-118 344 58 0 291 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Brucella suis biovar 1 (strain 1330)
A1JID8 5.3e-118 343 57 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q1CNC8 8.67e-118 343 59 0 287 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Yersinia pestis bv. Antiqua (strain Nepal516)
Q7CKV6 8.67e-118 343 59 0 287 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Yersinia pestis
Q1CBH4 8.67e-118 343 59 0 287 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Yersinia pestis bv. Antiqua (strain Antiqua)
Q578E7 1.12e-117 342 58 0 291 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Brucella abortus biovar 1 (strain 9-941)
Q2YKR6 1.12e-117 342 58 0 291 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Brucella abortus (strain 2308)
Q6CZ32 1.39e-117 342 57 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q66FU6 2.53e-117 342 59 0 287 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7CRU3 3.21e-117 341 61 0 291 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Agrobacterium fabrum (strain C58 / ATCC 33970)
P10905 3.47e-117 341 56 0 294 1 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Escherichia coli (strain K12)
Q8FCQ0 8.42e-117 340 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1R5H6 8.51e-117 340 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Escherichia coli (strain UTI89 / UPEC)
A1AGY3 8.51e-117 340 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Escherichia coli O1:K1 / APEC
Q7AA80 9.6e-117 340 56 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Escherichia coli O157:H7
Q83PU6 1.13e-116 340 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Shigella flexneri
Q0SZM0 1.13e-116 340 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Shigella flexneri serotype 5b (strain 8401)
Q0TC08 1.5e-116 340 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8ZLF2 1.06e-115 338 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q32AT4 1.09e-115 337 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Shigella dysenteriae serotype 1 (strain Sd197)
Q8Z247 1.44e-115 337 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Salmonella typhi
Q5PJK9 3.73e-115 336 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57IS1 3.73e-115 336 55 0 294 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Salmonella choleraesuis (strain SC-B67)
Q8YCA8 1.01e-112 330 57 2 292 3 ugpA sn-glycerol-3-phosphate transport system permease protein UgpA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q9KEF0 7.94e-34 128 34 11 288 3 araP Arabinooligosaccharides transport system permease protein AraP Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O34706 1.83e-31 122 29 3 277 1 melD Melibiose/raffinose/stachyose import permease protein MelD Bacillus subtilis (strain 168)
Q8FVS6 1.21e-30 119 29 2 286 3 BRA0749 Probable ABC transporter permease protein BRA0749/BS1330_II0742 Brucella suis biovar 1 (strain 1330)
O32155 1.36e-30 119 26 5 286 3 yurN Probable ABC transporter permease protein YurN Bacillus subtilis (strain 168)
O50500 4.36e-30 119 30 7 285 1 ngcF Diacetylchitobiose uptake system permease protein NgcF Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O31519 1.59e-29 117 31 9 286 3 yesP Probable ABC transporter permease protein YesP Bacillus subtilis (strain 168)
Q2YL00 9.09e-29 114 28 2 286 3 BAB2_0490 Probable ABC transporter permease protein BAB2_0490 Brucella abortus (strain 2308)
Q578M9 9.09e-29 114 28 2 286 3 BruAb2_0483 Probable ABC transporter permease protein BruAb2_0483 Brucella abortus biovar 1 (strain 9-941)
P37730 1.24e-28 114 26 7 297 3 amyD Probable starch degradation products transport system permease protein AmyD Thermoanaerobacterium thermosulfurigenes
P29823 1.83e-27 111 31 9 297 2 lacF Lactose transport system permease protein LacF Rhizobium radiobacter
Q7MFC2 1.29e-26 112 30 10 257 3 malF Maltose/maltodextrin transport system permease protein MalF Vibrio vulnificus (strain YJ016)
Q8D3U8 1.29e-26 112 30 10 257 3 malF Maltose/maltodextrin transport system permease protein MalF Vibrio vulnificus (strain CMCP6)
Q9KL06 1.09e-25 109 31 10 257 3 malF Maltose/maltodextrin transport system permease protein MalF Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P18812 1.13e-25 109 29 6 255 3 malF Maltose/maltodextrin transport system permease protein MalF Klebsiella aerogenes
O51924 6.24e-25 104 28 5 291 1 malF Trehalose/maltose transport system permease protein MalF Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q8Z1U2 6.27e-25 107 30 8 257 3 malF Maltose/maltodextrin transport system permease protein MalF Salmonella typhi
P26467 7.54e-25 107 30 8 257 3 malF Maltose/maltodextrin transport system permease protein MalF Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P02916 7.43e-24 104 28 5 255 1 malF Maltose/maltodextrin transport system permease protein MalF Escherichia coli (strain K12)
Q7A937 7.5e-24 104 28 5 255 3 malF Maltose/maltodextrin transport system permease protein MalF Escherichia coli O157:H7
Q8FB38 9.67e-24 103 28 5 255 3 malF Maltose/maltodextrin transport system permease protein MalF Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P94529 2.1e-23 100 30 9 272 1 araP Arabinooligosaccharides transport system permease protein AraP Bacillus subtilis (strain 168)
Q7CS30 7.35e-23 99 31 3 264 1 smoG Sulfoquinovosyl glycerol transport system permease protein SmoG Agrobacterium fabrum (strain C58 / ATCC 33970)
Q83P81 2.89e-22 99 27 5 255 3 malF Maltose/maltodextrin transport system permease protein MalF Shigella flexneri
P55602 3.82e-22 97 27 2 231 3 NGR_a02190 Probable ABC transporter permease protein y4oQ Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P9WG03 4.78e-22 96 28 5 278 1 sugA Trehalose transport system permease protein SugA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WG02 4.78e-22 96 28 5 278 3 sugA Trehalose transport system permease protein SugA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q74RF9 9.54e-22 98 28 9 254 3 malF Maltose/maltodextrin transport system permease protein MalF Yersinia pestis
Q87GB7 1.27e-21 97 29 10 254 3 malF Maltose/maltodextrin transport system permease protein MalF Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
O58968 3.08e-21 94 29 3 228 3 PH1215 Probable ABC transporter permease protein PH1215 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q7N984 4.25e-20 93 28 8 259 3 malF Maltose/maltodextrin transport system permease protein MalF Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q00750 6.84e-20 90 27 6 280 3 msmF Multiple sugar-binding transport system permease protein MsmF Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P75263 1.58e-19 90 27 6 216 3 MPN_135 Probable ABC transporter permease protein MG188 homolog Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
P0AFR8 1.14e-16 81 27 6 258 3 ycjO Inner membrane ABC transporter permease protein YcjO Shigella flexneri
P0AFR7 1.14e-16 81 27 6 258 1 ycjO Inner membrane ABC transporter permease protein YcjO Escherichia coli (strain K12)
P40979 3.58e-15 74 30 2 137 3 None Putative ABC transporter permease protein ORF1 (Fragment) Caldicellulosiruptor sp. (strain Rt8B.4)
P47434 2.85e-13 72 26 4 176 3 MG188 Probable ABC transporter permease protein MG188 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
O58759 1.16e-12 70 23 5 281 3 PH1038 Probable ABC transporter permease protein PH1038 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O32261 1.57e-12 70 27 8 258 1 ganP Galactooligosaccharides transport system permease protein GanP Bacillus subtilis (strain 168)
Q9K490 5.22e-12 68 26 9 257 1 dasB Diacetylchitobiose uptake system permease protein DasB Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
D4GP36 5.6e-12 68 27 5 224 1 xacH Xylose/arabinose import permease protein XacH Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q55472 3.24e-11 65 26 9 257 1 ggtC Osmoprotective compounds uptake permease protein GgtC Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9Z3R6 1.02e-10 65 28 6 202 3 aglF Alpha-glucoside transport system permease protein AglF Rhizobium meliloti (strain 1021)
P39128 6.52e-10 62 24 5 229 3 lplB Protein LplB Bacillus subtilis (strain 168)
C0SPB3 2.37e-09 60 27 7 232 1 yteP Polygalacturonan/rhamnogalacturonan transport system permease protein YteP Bacillus subtilis (strain 168)
Q97UZ0 1.6e-08 58 25 4 190 1 glcT Glucose import system permease protein GlcT Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
O06990 2.47e-08 58 24 7 205 3 mdxF Maltodextrin transport system permease protein MdxF Bacillus subtilis (strain 168)
P0A4N2 3.03e-07 54 25 4 174 3 malC Maltodextrin transport system permease protein MalC Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P0A4N1 3.03e-07 54 25 4 174 3 malC Maltodextrin transport system permease protein MalC Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
O06991 1.35e-05 49 26 9 204 3 mdxG Maltodextrin transport system permease protein MdxG Bacillus subtilis (strain 168)
O34518 0.000236 45 33 1 81 1 melC Melibiose/raffinose/stachyose import permease protein MelC Bacillus subtilis (strain 168)
Q7LYX6 0.000318 45 29 10 215 1 malG Trehalose/maltose transport system permease protein MalG Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17995
Feature type CDS
Gene ugpA
Product sn-glycerol-3-phosphate ABC transporter permease UgpA
Location 3953619 - 3954503 (strand: -1)
Length 885 (nucleotides) / 294 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3912
Orthogroup size 2
N. genomes 1

Actions

Genomic region

Domains

PF00528 Binding-protein-dependent transport system inner membrane component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1175 Carbohydrate transport and metabolism (G) G ABC-type sugar transport system, permease component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05814 sn-glycerol 3-phosphate transport system permease protein ABC transporters -

Protein Sequence

MASQSVYFKQKWLPIALIFPQLAITLVFFIWPAGQALLQSFQLEDAFGLSSEFVGLENFQRLFNDNYYFDSLITTLIFSTSVVLLSMLSAVILAGIAEQILRGKLFYRTILIAPYAIAPVIAGFLWLFMLDPTIGVLSRVLNKIGINWDPVLNTSHAMWMVILTATWKQISYNFLFFLAALQSVPKSLLEAAAIDGSGPIKRFITISLPLISPTTFFLLVVNFAYAFFDTFPIIHAMTQGGPGNSTSTLVYKVYNDGFVGLDLGSSAAQSVILMLIVAILTIIQFRYVEKKVAY

Flanking regions ( +/- flanking 50bp)

GAACATCAATAAGTGTTCGCCTGTTATTTTGTCAGATCTCTGGATACAGTATGGCTTCCCAATCCGTTTACTTTAAACAAAAATGGTTACCTATCGCGCTGATCTTCCCTCAATTAGCCATTACTTTAGTTTTCTTTATTTGGCCGGCTGGACAAGCATTGTTGCAATCTTTTCAGTTAGAAGATGCTTTTGGCCTTAGTAGTGAATTTGTTGGTTTAGAAAATTTTCAGCGCTTATTTAATGATAATTATTATTTTGACAGCTTAATCACCACGCTTATTTTTAGTACCAGTGTTGTATTACTTTCAATGTTATCTGCGGTTATTTTAGCGGGTATTGCTGAGCAAATATTACGGGGTAAATTGTTTTACCGCACAATACTTATCGCTCCTTATGCTATTGCTCCTGTTATCGCAGGTTTTCTCTGGTTGTTTATGCTCGATCCTACCATTGGTGTATTAAGCCGAGTATTAAACAAAATCGGTATCAATTGGGATCCGGTCTTAAATACATCTCATGCAATGTGGATGGTGATTTTAACCGCCACATGGAAACAGATAAGCTATAACTTTCTGTTTTTTCTTGCCGCGTTACAATCTGTGCCTAAATCGTTGCTAGAAGCAGCAGCCATTGATGGCAGTGGTCCAATTAAACGTTTTATTACCATTAGTTTGCCATTAATTTCGCCGACAACTTTTTTCTTATTGGTGGTGAATTTTGCCTACGCCTTTTTTGACACCTTTCCCATCATTCATGCCATGACCCAAGGTGGCCCCGGTAATAGCACCTCAACATTAGTTTATAAAGTGTATAACGATGGATTTGTTGGATTAGATTTAGGCTCATCAGCGGCACAATCGGTTATTTTAATGTTGATTGTTGCCATATTGACCATTATTCAATTTCGTTATGTTGAGAAAAAGGTGGCTTACTAATGGTTGAACGTAGACCTCTCTTCCACGCTTTTTGCCATCTTATTCTGATT