Homologs in group_4448

Help

0 homologs were identified in 0 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product

Distribution of the homologs in the orthogroup group_4448

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_4448

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q796S4 9.1e-20 84 31 0 110 4 yhjH Uncharacterized HTH-type transcriptional regulator YhjH Bacillus subtilis (strain 168)
P40762 4.16e-17 77 29 1 145 1 pchR HTH-type transcriptional regulator PchR Bacillus subtilis (strain 168)
O34692 2.55e-11 61 29 0 106 4 yvnA Uncharacterized HTH-type transcriptional regulator YvnA Bacillus subtilis (strain 168)
P0DPR8 0.000806 40 23 0 73 1 farR HTH-type transcriptional regulator FarR Neisseria gonorrhoeae

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS17975
Feature type CDS
Gene -
Product MarR family transcriptional regulator
Location 3949917 - 3950393 (strand: 1)
Length 477 (nucleotides) / 158 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_4448
Orthogroup size 1
N. genomes 1

Actions

Genomic region

Domains

PF01047 MarR family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1846 Transcription (K) K DNA-binding transcriptional regulator, MarR family

Protein Sequence

MTKQQVTTQELLNGLSELLHLKEANNDEGHKKVLAEKGLENYSLTELHVIHCIGEESMRNLTTISDYMAMTRGAVSKICRRLQSKGAIEKIKLADNQKEIFFILTTEGEKLFHTHELLHQQSQAKWITLFEQYDQNERRAIKRFLADVANRFRHKKKA

Flanking regions ( +/- flanking 50bp)

GTAAATAGTTTTGGTATTATTTTTTAAAATATTTTTTCCAAGGAAACAAAATGACAAAACAGCAAGTAACCACACAGGAATTGCTTAATGGTTTAAGTGAATTGTTGCACTTAAAAGAAGCGAATAATGATGAAGGTCATAAGAAAGTATTAGCAGAGAAGGGGTTAGAAAATTATTCACTCACAGAGCTTCATGTGATCCATTGTATTGGTGAAGAGAGTATGCGTAACCTCACAACGATCAGTGATTATATGGCAATGACACGTGGGGCCGTCTCAAAAATTTGTCGTCGCTTACAGAGTAAAGGCGCTATTGAGAAAATAAAATTAGCGGATAACCAAAAAGAGATATTTTTTATTTTAACTACTGAAGGGGAAAAGCTGTTTCACACTCATGAATTGTTACATCAACAATCTCAGGCAAAATGGATAACCTTATTTGAACAGTATGATCAAAATGAAAGGCGGGCAATTAAACGCTTTTTAGCTGATGTTGCAAATCGTTTTCGCCACAAGAAAAAAGCATAAAGAAAACCCCCATATGGTTAAATATAGGGGCGATAAAGTTTATTTTTTAT